HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0570COG2719arCOG04632Uncharacterized conserved proteinspore cortex synthesis protein

HOG Organism Gene ID Name Annotation
cHOG0570 nrc1 VNG0745 spoVR spore cortex synthesis protein
cHOG0570 hmu HMUK2234 Hmuk_2234 stage V sporulation protein R-like
cHOG0570 hma RRNAC1070 secE preprotein translocase subunit SecE
cHOG0570 hwa HQ3000A spoVR spore cortext formation protein
cHOG0570 hla HLAC0029 Hlac_29 SpoVR family protein
cHOG0570 hbo HBOR13570 Hbor_13570 uncharacterized conserved protein
cHOG0570 hut HUTA0409 Huta_0409 stage V sporulation protein R-like
cHOG0570 hvo HVO_2846 HVO_2846 spoVR stage V sporulation protein R-like
cHOG0570 nph NP3450A prkA cluster protein
cHOG0570 hhi 1679 HAH_1679 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10700|gene|hma      -------------------------------------MDVPY------------------
29|gene|hla         ----MRDERVEAKREAESLGVPAAEARALAERLGLEPYPVRYWIVDHDEMNELIAYGGFQ
745|gene|nrc1       ----MTRPDPAKHAAAQTLDEPAREANALARKLGLDPYDVQYWVVDHDEMNELIAYDGFQ
3000|gene|hwa       MSSRPIRFRRRAQAEADQLEEPATEAAALAKKLGLDPYPVNYWIVGHDEMNQLIAYGGFQ
13570|hp|hbo        ----MRRFRHTAQKVAGELEESVREAGNLARKLGLKPYPVNYWVVNYDEMNQLIAYGGFQ
2846|gene|hvo       --MSFRRHRRDAQREAARLDEPVREAGALAKKLGLDPYPVNYWVVNYDEMNQLIAYGGFQ
3450|gene|nph       ---MTTNDRFHKQRVAGQLEEPAHEANALARKLGLDPFDVNYWIIDYDEMNELVAYGGFQ
409|gene|hut        --MSPIENRTDAKETARRLRDPVEKAGELARALGLDPYPVNYWIVDHDEMNQLIAYGGFQ
1679|hp|hhi         ----MNDDRFAKQRVADDLDEPVEEAGNLARKLGLKPYPVNYWIVDYDEMNELIAYGGFQ
                                                           * *                  

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         RRYPHWRWGMNYERQSKLDRHGLGKAFEIVNNDDPSHAFLQESNSPADQKAVITHVEAHA
745|gene|nrc1       TRYPHWRWGMKYEKQRKQTQFLGGKAFEIVNNDDPSNAFLQVSNDLADQKAVITHVEGHA
3000|gene|hwa       RRYPHWRWGMTYDRQQKQDQFGMGKAFEIVNNDDPSHAFLQESNSLADQKAVITHVEGHA
13570|hp|hbo        RRYPHWRWGMTYDRQQKKDQFGMGKAFEIVNNDNPSHAFLQESNSLADQKAVITHVEAHA
2846|gene|hvo       ERYPHWRWGMTYDRQRKTDQFGMGKAFEIVNNDDPANAFLQESNSLADQKAVITHVEAHS
3450|gene|nph       RRYPHWRWGMSYDRQRKQRQFLGGKAFEIVNNDDPSNAFLQVSNDMADQKAVITHVEAHA
409|gene|hut        QRYPHWRWGMAYDRQQKQGQFLGGKAFEIVNNDNPAHAFLQESNSMADQKAVITHVEAHA
1679|hp|hhi         QRYPHWRWGMQYDRQQKQGQFLGGKAFEIVNNDDPAHAFLQESNTLADQKAVITHVEAHA
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         DFFANNRWFGLYADR------------GKGGPNAAARLERNADRIAAIADRPEVDRDEVE
745|gene|nrc1       DFFNNNQWFGLFADG--------------EGPDAAAMLERHADRVASFLSDPEIGRESVE
3000|gene|hwa       DFFKNNNWFSRFSGD--------------QELDAAAMLERHGETIQGYVDDPDIDRDDVE
13570|hp|hbo        DFFSNNEWFGMFAGD--------------SDLDAAAMLEQHGETIQKYMDDPDIDREDVE
2846|gene|hvo       DFFKNNQWFGLFSDE--------------GQFAAAAMLERHAQTIERYVQNPDISRDDVE
3450|gene|nph       DFFKNNEWFRLFDTS----------------PDAAAMLERHAETVEEYISDPDISREDIE
409|gene|hut        DFFANNEWFGLFSHG-----VDQRADPDRRGPDATAMLARHADRIREFMQDPEIDRGAVE
1679|hp|hhi         DFFANNEWFRMFTDGSSRTTTDASGEDRRRGPDAAGMLARHGDTIQEYMQDPDIERAEVE
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         RLIDAVSALEDTIDQHSPADAARSV--DEPGVDEDVNGPDDDPLAAIEERIAELDLSEEV
745|gene|nrc1       RFIDTVLTIEDNIEYRRAFDR------DAEGGDPD----------ALAETLASLGVSEEV
3000|gene|hwa       RFIDAVLCLEDTIDQHRPVDVDP----DTERTQPT----------DLRDQLDQLDLSDDV
13570|hp|hbo        RFIDAVLCLEDNIDQHRTITDAAT---GRERVQPE----------DLRKRLDEMDISQDV
2846|gene|hvo       KFIDAVLCLEDTIDQHRTIREAAA---DEDGRIPE----------DIRAQLDSLDISDDV
3450|gene|nph       AWIDHILCLEDNIDQHQPFAPAESE--DGAETPAG----------DITETLESLDVSEAV
409|gene|hut        RWIDHVLCLEDTIDQHAAYAPVEPTEEDGEIDGP-----------DPEAAIEELDLSAEV
1679|hp|hhi         RFIDHVLCLEDNIDQHIPYSPVETVPEEFEDIEGA----------DVTEQLDDLELSEEV
                                                                                

10700|gene|hma      ----------------------------DLTSYIRVLKLASTPS---------WEE----
29|gene|hla         RRDVFDDEWLEARGEGVE----PEEPRPDVLAFLRDYGKRYDPESGKAVDREPWETTVID
745|gene|nrc1       RDEVFTETWLDDIAAVDDSVQFPETPEYDLLAFLRDHGQAYDEDAEKAAAFEDWQRELLE
3000|gene|hwa       QQQVFDQEWLDELAESEAASASIDHPQTDVLGFLRDHATTYDDEEDEAVAMESWQLDILD
13570|hp|hbo        RKQVFDEEWLDELAEAEAEAAKLDDPRRDVLAFVREHGMYYDEEEGKAVEMESWQKDVLD
2846|gene|hvo       RREVFDDAWLEQVEEAEREAAKLTDPRKDVLAYVREHGMRYDEETGKAEEMEPWQKDVLD
3450|gene|nph       RDQVFDEEWRESVAGDGDGATVPPEPERDVLGFLATHGKAYDEESGKAVGYEDWQQEVLE
409|gene|hut        TGQVFDEAFFDERADEDAG--FPPEPVEDLIGFLAVHGKQYDEETDRALEMTDWQREILE
1679|hp|hhi         KRQVFDEEWLDAQRDDDENVTFPAEPEKDVLGFLRKHGMQYDEDAERATEMEDWQTELLE
                                                *: .::         .         *:     

10700|gene|hma      --------FS--QIAKIAGAGIA-------------------------------------
29|gene|hla         ALREEAYYFAGQKSTKVMNEGWA-------------------------------------
745|gene|nrc1       LLRREAYYFAPQRTTKVMNEGWA-------------------------------------
3000|gene|hwa       TLRREAYYFAPQKMTKVMNEGWA-------------------------------------
13570|hp|hbo        ILRTESYYFAPQKMTKVMNEGWA-------------------------------------
2846|gene|hvo       MLREEAYYFAAQKMTKVMNEGWA-------------------------------------
3450|gene|nph       LLRKEAHYFAPQKLTKVMNEGWA-------------------------------------
409|gene|hut        LLRREAHYFAPQKMTKVMNEGWA-------------------------------------
1679|hp|hhi         LLRREAYYFAPQKMTKVMNEGWACVDPETPVFTADGLVPMEDVVSDHVTVSDGEQAREVY
                            *:  . :*: . * *                                     

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         ------------------------------------------------------------
745|gene|nrc1       ------------------------------------------------------------
3000|gene|hwa       ------------------------------------------------------------
13570|hp|hbo        ------------------------------------------------------------
2846|gene|hvo       ------------------------------------------------------------
3450|gene|nph       ------------------------------------------------------------
409|gene|hut        ------------------------------------------------------------
1679|hp|hhi         DSNIIPDHDTVTIETRRGFELTGSNNHRVRQPDGDWVRLDELETGDEIAVTGGNGTWPET
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         ------------------------------------------------------------
745|gene|nrc1       ------------------------------------------------------------
3000|gene|hwa       ------------------------------------------------------------
13570|hp|hbo        ------------------------------------------------------------
2846|gene|hvo       ------------------------------------------------------------
3450|gene|nph       ------------------------------------------------------------
409|gene|hut        ------------------------------------------------------------
1679|hp|hhi         NVPIEWTCSEYTSLNDVADEAGVSVWTVMRYRRTGSAEKAEAIDRALDGYEEGGNAGLSN
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         ------------------------------------------------------------
745|gene|nrc1       ------------------------------------------------------------
3000|gene|hwa       ------------------------------------------------------------
13570|hp|hbo        ------------------------------------------------------------
2846|gene|hvo       ------------------------------------------------------------
3450|gene|nph       ------------------------------------------------------------
409|gene|hut        ------------------------------------------------------------
1679|hp|hhi         RESIRIPETVDELFGRFLGLLIGDGHVPSNSRHIGFTSGKQAHAEEFAGLLSELFGIEAT
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         ------------------------------------------------------------
745|gene|nrc1       ------------------------------------------------------------
3000|gene|hwa       ------------------------------------------------------------
13570|hp|hbo        ------------------------------------------------------------
2846|gene|hvo       ------------------------------------------------------------
3450|gene|nph       ------------------------------------------------------------
409|gene|hut        ------------------------------------------------------------
1679|hp|hhi         VERQESRWRVYAYSKNLRDLLTEEFDLPTGVAAAEKTVPDQILRSPKQVVAEFIRGLFDA
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         ------------------------------------------------------------
745|gene|nrc1       ------------------------------------------------------------
3000|gene|hwa       ------------------------------------------------------------
13570|hp|hbo        ------------------------------------------------------------
2846|gene|hvo       ------------------------------------------------------------
3450|gene|nph       ------------------------------------------------------------
409|gene|hut        ------------------------------------------------------------
1679|hp|hhi         DGYAGEQGAILSTKSEDLSKRVQLLLTNFGVLSRRREQSDGCYHVHLTGASANTFADEIG
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         -----------------------------------------------------------T
745|gene|nrc1       -----------------------------------------------------------A
3000|gene|hwa       -----------------------------------------------------------S
13570|hp|hbo        -----------------------------------------------------------A
2846|gene|hvo       -----------------------------------------------------------A
3450|gene|nph       -----------------------------------------------------------A
409|gene|hut        -----------------------------------------------------------A
1679|hp|hhi         FGYEAKATELSTYLDELAWFETESWTDEIVDVETGTGDVYDISVEETHRYAAAGFVNHNS
                                                                                

10700|gene|hma      -----LVGLLG------FIIFA--------------------------------------
29|gene|hla         YWESVMMGGEGFADPDEFLTYADHMSRVLGSPGLNPYKLGFELWTHVELRAARRDVIDKL
745|gene|nrc1       YWESMMMGEEAFAGDDEFLSYADHQARVLNSPGFNPYKLGKELWEYVENRANRRAVLEHL
3000|gene|hwa       IVESLMMSDEGFADADEFITYADHQSRVLGSPGLNPYKLGKELWEYVENSANRREVADKL
13570|hp|hbo        YWESLMMGEERFAGTDEFLTYADHQSRVLGSPGLNPYKLGKELWEYIENTTNRREVADKL
2846|gene|hvo       YWESLMMGDERFAGTDEFITYADHQSRVLGSPGLNPYKLGKELWEYIENSTNRAEVADKL
3450|gene|nph       YYESLMMADERFADADEFISYADHMAQVLGSPGLNPYKLGFELWQYVENRRNRREVIERL
409|gene|hut        YWESMMMGEEAFAGTDEFLTYADHQARVLGSGGLNPYKLGKELWEYVENRTNRREVLERL
1679|hp|hhi         YWESTMMTGEQFAGDDEFILYSDHMSKVLGSGGLNPYSLGLEIWEYVENTENRREVIERL
                         ::          *: ::                                      

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         LRIEGVTPENFHSRIDLDEVAAALEPHPAIAGAGPATLDELAELAADRDPRVDAEAVDRA
745|gene|nrc1       LRVDGVTWRNFHDTVDTADVVDTLAPPAAVAAVAPDELDAVESLP---DAYVDWQGLAAA
3000|gene|hwa       LRVEGITWQNFHAEIDFEHVRALLEPDPRIDAISSDTVEQLTSLPGD-DPRIDWEMLDRA
13570|hp|hbo        LRVRGVTWRNFHDVIDFDEVQQLLEPHPAIDRVRSDTLDELAALPGD-DPRVDWEMLDRA
2846|gene|hvo       LRVTGVTWRNFHETVDFDEVQEHLRADPAIDGVSADSLDELSELGPD-DPRVDHETLDRA
3450|gene|nph       LRVDGVTWRNFDDTVDLDAVRDRLEPAPEVA----DPVSHLDALDPD-DERVDTEALSAA
409|gene|hut        LRVEGITWRNLENEVDFAAVRERLEPPAWVQNV-P---GWLESIDPD-DPRVDDDTLSGA
1679|hp|hhi         LRVEGITWRNFDESVDYKMVQDHLEPPAWLTAV-P---NHLDDLDPE-DPRVDSDGLAAA
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         LSARDGESPGTDSDAGPDSGPDIERYPWKLLTREGLAERHYVLSRPEHRNSLRNVSRETL
745|gene|nrc1       ---REREI-------------DVQRYPWKLFTYEGLAHRHYSLAKPQYRGFLGRVTRDEL
3000|gene|hwa       LS-NPETV-------------DIDRYPWKVLSYEGLAERHFSLVQPQHRGFLEQIRRSEL
13570|hp|hbo        LS-DDGEV-------------DVDAYPWKVLTYEGLAERHFSLVKPQNRGFLRHIRRSEL
2846|gene|hvo       LS-GDDSL-------------DLDAYPWKLLTYEGLAERHYSLVKSQNRGFLSRIRRSEL
3450|gene|nph       ---RDGDI-------------DVESYPWKLLTYEGLAERHYSLVKPQHRGFLKAVTKQEL
409|gene|hut        ---RDGDI-------------DVDRYPWKVLTYEGLAQRHYSLVKPQQRGFLERASKSDL
1679|hp|hhi         ---RDGEF-------------DVEQYPWKVLTYEGLAQRHYSLVKPQYRGFVSRVGQEEL
                                                                                

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         TEQARYMFDVDRYATVDEALADVDRATGWDRMLEVRESHNDVTFIDAFLTDEFVREGNYF
745|gene|nrc1       ESVSRYLFDTARYASVEAALADVPVTAGWDRMYSVRESHNDVTFVDEFLTQEFVDANEYF
3000|gene|hwa       QEHARYLFDDTRYDTVEDAIDDVDKTAGWDRMREVRESHNDVTFIDEFLTQEFVSENNYF
13570|hp|hbo        ERLSRYMFDNEAYETVEEAIADVDRASGWDRMQEIRESHNDVTFLDAFLTQEFVENNHYF
2846|gene|hvo       EQLSRYMFDDEVYDSVEDALADVDKTAGWDRMREIRESHNDVTFLDAFLSEEFVRANHYF
3450|gene|nph       EQVARYLFDTERYDAIEEAVDDVDRTAGWDRMHEVRESHNDVTFIDAFLTDEFVEANDYF
409|gene|hut        ESIARYLFDDQRYDTVEAALGDVDYTRGWDRMREIRESHNDVTFIDAFLTGEFVSANDYF
1679|hp|hhi         ERTARYMFDDSRYDSVEDALGDVDYSRGWERMREIRESHNDVTFLDEFLTQEFVDDNDYF
                                                                                

10700|gene|hma      -------------------------VMTFVPGSKPV------------------------
29|gene|hla         TYEYSRATEQHRVASVDADDVRKKLLLRFTNFGKPTVVVLDGNFRNRGELLLGHRYNGVA
745|gene|nrc1       AYEFSQTRGDFRATSTDAADVKRKLLLRFTNLGKPTIAVYDANHENRGELLLGHEYNGVM
3000|gene|hwa       TYEYTQTTEDYRVASTDYQDVKQKLLLQFTNFGKPTIAVFDDNFKNRGELLLGHRYNGIA
13570|hp|hbo        TYEFTQATGEFRVASVDYEDVKKKLLLQFTNFGKPTIVVFDGNYDNRGELLLGHQYNGIM
2846|gene|hvo       AYEYSQSSRQFRVSSSEYRDVKKKLLFQFTNFGKPTIAVYDGNFDNRGELLLGHQYNGVI
3450|gene|nph       TYEYTHTTEDFRATSTDAADVKKKLMLQFTNFGKPTIAVHDGNFRNRNELLLAHHYNGVQ
409|gene|hut        AYEHSQKTGDFRVSSVDAEDVKRKLMLEFTNFGKPTIVVEDANEDNSGELLLAHRYNGVM
1679|hp|hhi         TYEYTHASGDYRVTSTDHEDVKKKLMLQFTNFGKPTVVVEDGNYQNRNELLLAHQYNGVM
                                             :: *.  .**.                        

10700|gene|hma      ------------------------------------------------------------
29|gene|hla         LDEESARETLKRVFELWGRPANLATIRVEYSDEAIRRAMRRGTEPEGKEVGVRFQYDGGE
745|gene|nrc1       LDREQAEATLQRVFELWGRPVVLHTITKRVTDSERKRARRNDREPEPEEVGVALRYDGES
3000|gene|hwa       LDIQQATAVLERMHDLWGRPVNLMTITKTYEEHEVEVARRRNREPEPTETGVRLRYDGHE
13570|hp|hbo        LDIAQARGVLERLYDLWGRPVNLATIVKEYDEHDVEVARRRDREPTPVEQGKRIRYDGEE
2846|gene|hvo       LDMKQAKGVLERVYHLWGRPVNLMTITKEFDEHEVEVARRRGREPTPEERAIRIRYDGES
3450|gene|nph       LDIEQAKQTLERVFELWGRPVALKTIVKELSDHDIEVARRQDREPEPTEQGKLIRFDGED
409|gene|hut        LDIEEATDVLKRVFELWGRPVNLLTIAKEFDDREVDRARHGDREPDPVEVGKRLRYDGTQ
1679|hp|hhi         LDIGQAKEVLKRTFELWGRPVNLLTIVKEFDDHDVEVAKRRDREPEPEEVGKRIRYDGDE
                                                                                

10700|gene|hma      ------------------------------
29|gene|hla         VTEHDLDPEIKARIAADEIDYDTKPDDWLA
745|gene|nrc1       VSHAELDWETVEHLAADDLDYDTKPDEWL-
3000|gene|hwa       VTRSELDNDLTDRIRAADIDYDTKPDEWLA
13570|hp|hbo        FETYELDEEITERIRATDVDYDTKPEEWLS
2846|gene|hvo       FEEHDLDPELEARIAAGEVDYDTKPDDWL-
3450|gene|nph       FEIEDLPDEEIEDITATDVDYDTKPDEWL-
409|gene|hut        VTKETVEWETVEHLAADDVDYDTKPEEWL-
1679|hp|hhi         VTVTDVDWSEVEHLTATDIDYNTKPDEWLA