HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0057COG1078arCOG04430HD superfamily phosphohydrolaseshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0057 nrc1 VNG1537 vng1537 no entry
cHOG0057 nrc1 VNG2502 vng2502 no entry
cHOG0057 hmu HMUK2579 Hmuk_2579 metal dependent phosphohydrolase
cHOG0057 hma RRNAC3549 HD family metal dependent phosphohydrolase
cHOG0057 hwa HQ3011A hypothetical protein
cHOG0057 hla HLAC1569 Hlac_1569 metal dependent phosphohydrolase
cHOG0057 hbo HBOR11140 Hbor_11140 HD superfamily phosphohydrolase
cHOG0057 hbo HBOR11150 Hbor_11150 HD superfamily phosphohydrolase
cHOG0057 hut HUTA0760 Huta_0760 metal dependent phosphohydrolase
cHOG0057 hvo HVO_2481 HVO_2481 phosphohydrolase
cHOG0057 nph NP2030A hypothetical protein
cHOG0057 hhi 761 HAH_0761 HD family metal dependent phosphohydrolase
MUSCLE (3.6) multiple sequence alignment


11140|gene|hbo      -MTAVKDSVHDYISLDPLAQDLVDTPEFQRLRHIKQLSTVRLVYPSANHTRFEHSLGVYH
2502|chp|nrc1       -MRAIKDSVHDYIEADGVAAALLDTEPVQRLRHIKQLSTIRLVYPSANHTRFEHSLGVYH
1537|chp|nrc1       MTTTIKDSVHDHIEVTGVVAALLDTPPLQRLRNVAQLGTVSLVYPSANHTRFEHSLGVYH
2030|hp|nph         -MVTIKDSVHDHITVEGVAADLLDTPAVQRLRRITQLGTVEYVYPSANHTRFEHSLGVYH
760|gene|hut        -MKTIKDSVHDYIEVEGVALSLLDTPPLQRLRHVSQLGTVTLVYPSANHTRFEHSLGVYH
13549|gene|hma      -MTTIKDSVHDHIEVQGVAAALLDTPPVQRLRHISQLGTVTLVYPSANHTRFEHSLGVYH
761|gene|hhi        -MTTIKDSVHDHIEIQGVAAALLDTPPVQRLRHISQLGTVTLVYPSANHTRFEHSLGVYH
1569|gene|hla       -MITVKDTVHDHIEIDGVAADLLDTPAVQRLRHVKQLGTVQLVYPSANHTRFEHSLGVYH
3011|hp|hwa         -MTTIKDSVHDHIEIQGVAAALLDTPPIQRLRRVTQLGTVHLVYPAANHTRFEHSLGVYH
11150|gene|hbo      -MATIKDSVHDHIEVEGVAEALLDTEEVQRLRHIKQLGTVQLVYPSANHTRFEHSLGVYH
                       ::**:***:*    :.  *:**  .****.: **.*:  ***:**************

11140|gene|hbo      LASRALDYLDIGGDRARHVRAAALLHDIGHGPYGHQTEEVIRRRTGAHHDEIGHLLDETD
2502|chp|nrc1       LADRALAHLDISGTRADTVRAAALLHDIGHGPYGHQTEGIIQRRLDRHHDDVAHLVSNGE
1537|chp|nrc1       LADRALDHLGITGQRATRVRAAAILHDIGHGPFSHNVEDVIERHTGNRHDDVHDLVASGQ
2030|hp|nph         LATRALDHLGIEGTQAERLRAAAILHDIGHTPYSHNIEALVARRTGKLHDEVEDLLETGD
760|gene|hut        LADQALEHLGISGQQGERVRAAALLHDIGHGPYSHNVEGLIHRHTGKYHDDVHDLIGEGQ
13549|gene|hma      LADRVLSHLGIEGQQAERVRAAALLHDVGHSPYSHNVEALIHRRTGKYHDDVDELLGDGP
761|gene|hhi        LADRALSHLGIEGQQAERVRAAALLHDVGHSPYSHNVEALIHRRTGKYHDDVDELLGDGP
1569|gene|hla       LASRALGHLGIGGKRADRIEAAAMLHDVGHGPFSHNLESLTHRRTGKYHDDVDEVLATGA
3011|hp|hwa         LMNRALSHLDLDGPRAERLRAAALLHDVGHSPYSHNLEPVIHRYTGKYHDDVTNLLVDSA
11150|gene|hbo      LASRALTHLGIEGVQAERIRAAALLHDVGHGPYSHNIESVTYRYTGKYHDDVHELIAEGS
                    *  ..* :*.: * ..  : ***:***:** *:.*: * :  *  .  **::  ::    

11140|gene|hbo      VAAVLVAHDLNPDRIAALVRGDGE-LGQLVSGELDVDRMDYLVRDAHHTGVPYGTIDTGR
2502|chp|nrc1       PGAVLAAHGLDPDRVAALVAGHGK-LGQLVAGELDVDRMDYLVRDAHHTGVPYGTIDHGR
1537|chp|nrc1       VASVLADHDIQPAEIAALVAGDGEPLAQLVAGELDVDRMDYLVRDAHHTGVPYGTIDHGR
2030|hp|nph         VARTLALHDIDPSAVADLIAGDGE-FGPLVSGELDVDRMDYLVRDAHHTGVPYGTIDAGR
760|gene|hut        VARVLTEAGLNPDAVADLVAGDGE-LGQLVSGELDVDRMDYLVRDAHHTGVPYGTIDHGR
13549|gene|hma      VARVLTEHGLNPDRVAGLVAGEGE-LGQLVSGELDVDRMDYLVRDAHHTGVPYGTIDHER
761|gene|hhi        VARVLSEHGLNPDRVAGLVAGEGE-LGQLVSGELDVDRMDYLVRDAHHTGVPYGTIDHER
1569|gene|hla       VGEVLRDHDLDPEKIAGLVAGEGP-YGGLVSGELDVDRMDYLVRDAYHTGVPYGTIDTER
3011|hp|hwa         VGDTLSDRGYDPERIAALIRGDGK-YGQLISGELDVDRMDYLVRDAHHTGVPYGTIDHER
11150|gene|hbo      VGQVLRDNDLDPNRIADLVAGEGK-YGQLVSGELDVDRMDYLVRDAHHTGVPYGTIDHER
                     . .*   . :*  :* *: * *   . *::***************:**********  *

11140|gene|hbo      LVRELRYRD-----GELVLADGNVQTAESLLLARALMNGTVYRHHVSRIAGAMLERASER
2502|chp|nrc1       LLRALTFRD-----GDLVLAEGNVATAESVLVGRALMNATVYRHHVSRIAGAMLDRASAR
1537|chp|nrc1       LIRGLTFID-----GDLVLGAGNVQSAESLLLARALMNPTVYSHHVARISKSMLRRAAET
2030|hp|nph         LIRELRFVD-----GELVLAEGNVQTAESLLVARALMNPVVYNHHVARISKAMLRRATEQ
760|gene|hut        LVRELRFRD-----GELVLAEGNVQTAESLLLARALMTPTVYSHHVARIAKAMLRRGSAR
13549|gene|hma      LVRELCFVD-----GELVLDEGNVQTAESLLLARALMNPTVYQHHVARIAKSMLRRGTEE
761|gene|hhi        LVRELCFVD-----GELVLDEGNVQTAESLLLARALMNPTVYQHHVARIAKSMLRRGTEE
1569|gene|hla       FVRELTFVDVGTGTNELVLDEGNVQTAESLLLARALMNPVVYTHHVARISKAMLRRAASD
3011|hp|hwa         LIRALTFVD-----GELVLAAGNVQTAESLLLARALMNPTVYRHHVARISKTMLRRAAEQ
11150|gene|hbo      LIRELTFVD-----GELVLDEGNVQTAESLLLARALMNPTVYQHHVARISKAMLRQATER
                    ::* * : *     .:***  *** :***:*:.****. .** ***:**: :** ..:  

11140|gene|hbo      LL--DTGEVGIDEFRRMADHDLLVSL--SEHVPDLGRRIERRDLYKRAVWAPLASVPASV
2502|chp|nrc1       LL--DTTDLDAETFARFTDADLLAVLRDCPATQDAARRIRNRDLYKRAVWTERDAVPDDV
1537|chp|nrc1       LL--ATTDVTAPALRRMDDHDLVAALRAHDATSRVAARLFERDLYKRAVWAELGDVDDDL
2030|hp|nph         LL--TAGVTDAETLRRMDDAALRSALRDCAATAPLATRLDRRTLYKRAVWAELRDVPDDI
760|gene|hut        LL--EETETSPETFRRMDDAELLVALRSTEETAEIGRRLTYRDLYKRAVWAERGAVPADL
13549|gene|hma      LL--AATDTTAETLRRWDDNDLLVALRQCDATAAYARRLSQRDLYKRAVWAEWQAVPDEV
761|gene|hhi        LL--AATDTTAEALRRWDDNDLLVALRQCDATEAYARRLSQRDLYKRAVWAEWGAVPDEI
1569|gene|hla       LL--DATTTTPAQLRRMDDHDFLAAIRSCSETAELSRRYDERDLYKRAVWAEYDDVAERV
3011|hp|hwa         LITTDTTAITASQLRRMDDHDLHVALRSTKATTHIASRLDTRDLYKRAVWAELDTVPESV
11150|gene|hbo      LL--DQPDLTAAELRRMDDHDLLAALRMTPETKPFADRLDSRDLFKRAVWAEMDAVPDDV
                    *:           : *  *  :   :     .   . *   * *:*****:    *   :

11140|gene|hbo      VEMDYAETRSAAREIADKAGVEPDEVLVDVPSRPSFKESRTRVIVNGVVQRLEEASELVA
2502|chp|nrc1       ATADYRTVRDLESQVADAAGVPATAVVIDTPGAPSMPESSVRVTVNGDTRRLDEQSPLVD
1537|chp|nrc1       VGADHDTVRGFERAIAADAGVPERDVIVDAPSEPSMPESSTGVLVNGEVRRLHEQSTLVT
2030|hp|nph         VDADHETCREHERAIAERAGVDPAAVIIDVPSRPSMRESTSRVVVGGEVRTLGSQSTLVA
760|gene|hut        LAMEQGAIRERERAIAADAGVDPEAVILDVAPDPSMAESSSQVLVNGTVRRLEEQSTLVR
13549|gene|hma      LAADHDAVGAMEQAIADEANVDSDAVVLDIPPEPSMTESSSRVLVNGGVRRLGEQSTLVN
761|gene|hhi        LAADHEAVGAMEQAIADEANVDSDAVVLDIPPEPSMTESSSRVLVNGDVRRLGEQSTLVN
1569|gene|hla       HEADHDTESALEREIAEEAGVARQHVILDVPPEPSMRESTARVTVNGEVRRLERQSPLVS
3011|hp|hwa         INADHDTIRSFERTVADRVGLDSEEVIIDIPGHPSMTESSSRVVVSGEVRRLADQSPLVS
11150|gene|hbo      IDADHTTYRDFESRIAARADIDPESVIVDVPSRPSMTESTSRVMVSGEIRRLGKQSPLVS
                       :          :*  ..:    *::* .  **: **   * *.*  . *   * ** 

11140|gene|hbo      GLRAAERTQWRIGVYAPAEAADDVRDAAADVLGL-------AEVRV-GLAE---------
2502|chp|nrc1       GMLASQRAQWRFGVYTPDDHVPAVAAAAERTLGL----GPIDDPPA--------------
1537|chp|nrc1       ALQTAQREQWRLGVYTPRAHTDVVGRATERVLGLDPDDGLVTEVNA--PDDSPPGFSE--
2030|hp|nph         ALRRTQREQWRLGVYAPEAETDAVGSAAEDILGLDLD-ALVVDVRQ-GVNTRLDEFQE--
760|gene|hut        ALQAAQRDRWRLGVYAPTDVRERVGDAAVRTLGLDIDGARVSDTPR-GIHATLDEFE---
13549|gene|hma      AIRAAQRDQWRLGVYAPDAESERVGAAAIRELGLDLDGARVRDVRT-GIHATLDEFN---
761|gene|hhi        AIRAAQRDQWRLGVYAPEDESERVGAAAIRELGLDLDGARVRDVRP-GLHATLDEFN---
1569|gene|hla       TLRTAQRNQWRLGVYAPHPATDRVGRAAADVLGLDPD-GLVAEVRG-AMPTTLDEFRDGA
3011|hp|hwa         ALRTAQKQQWRLGVYVPATATDRAGIDAVETMGLDISGAPVSDIQHKTVTATLDEFSD--
11150|gene|hbo      ALRTAQKQQWRFGVYAPADETDAVGRAAVEEMGLDIDDALISDVRH-GVHTTLDEFAE--
                     :  ::. .**:***.*      .   :   :**        :