HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0568COG1013arCOG01599Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases beta subunitputative 2-ketoglutarate ferredoxin oxidoreductase (beta)

HOG Organism Gene ID Name Annotation
cHOG0568 nrc1 VNG1125 korB putative 2-ketoglutarate ferredoxin oxidoreductase (beta)
cHOG0568 hmu HMUK2161 Hmuk_2161 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit( EC:1.2.7.3 )
cHOG0568 hma RRNAC1268 korB
cHOG0568 hwa HQ3355A porB pyruvate--ferredoxin oxidoreductase, beta subunit
cHOG0568 hla HLAC0890 Hlac_890 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit
cHOG0568 hbo HBOR19210 Hbor_19210 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family( EC:1.2.7.3 )
cHOG0568 hut HUTA2847 Huta_2847 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit
cHOG0568 hvo HVO_1304 HVO_1304 beta 2-oxoglutarate ferredoxin oxidoreductase beta subunit
cHOG0568 nph NP4044A porB pyruvate--ferredoxin oxidoreductase, beta subunit
cHOG0568 hhi 1862 korB putative 2-ketoglutarate ferredoxin oxidoreductase (beta)
MUSCLE (3.6) multiple sequence alignment


4044|gene|nph       -MSAFNAIDDSEDVERDDFTPGIEPQATWCPGCGDFAVLKALKGAMAELGKNPEEVLLVT
3355|gene|hwa       -MSAFSAIGEEQEHDRSEYTPGLEPQATWCPGCGDFGVLKALKGAAAELGLAPEEMLVCT
19210|gene|hbo      -MSAFSAIGEEAERDRNEYTPGLEPQPTWCPGCGDFGVLKALKGAAAELGLSPEEMLVVT
1125|gene|nrc1      MSKAFSAIDEDREVDRDAFTPGVEPQPTWCPGCGDFGVLKALKGAMAELGKDPEEILLAT
1862|gene|hhi       -MSAFSAINEEREIERDEFTPGIEPQATWCPGCGDFGVLKALKQAMPEVGKNPDEVALFT
890|gene|hla        -MSTFSAIGEEREIDRDEYTPGVEPQPTWCPGCGDFSVLKALKQALPEVGRTPEETLLCT
2847|gene|hut       -MSAFSAIGEDREIDSEEYTPGIEPQATWCPGCGDFSVLKALKQAMPEVGRTPEEVLTVT
                      .:*.**.:. : : . :***:***.*********.****** * .*:*  *:*    *

4044|gene|nph       GIGCSGKLSSYFESYGFHTLHGRALPIARAAKLANPDLEVIAAGGDGDGYGIGGNHFAHT
3355|gene|hwa       GIGCSGKLNSYFESYGFHTIHGRSLPVARAAKVANDGLTVVAAGGDGDGYGIGGNHFMHT
19210|gene|hbo      GIGCSGKLNSYFESYGFHTIHGRSLPIARAAKLANSGLTVVAAGGDGDGYGIGGNHFMHT
1125|gene|nrc1      GIGCSGKLNSYFDSYGFHTIHGRSLPVARAAKLANHDLEVVAAGGDGDGYGIGGNHFMHT
1862|gene|hhi       GIGCSGKLNSYFNSYGFHTIHGRSLPVARAAKLANPNLEVIAAGGDGDGYGIGGNHTIHT
890|gene|hla        GIGCSGKLNSYLDTYGFHTIHGRSLPVARAAKLANPDLEVIAAGGDGDGYGIGGNHFIHT
2847|gene|hut       GIGCSSKLNSYFDSYGFHSIHGRSLPIARAAKLANPDLEVIAAGGDGDGYGIGGNHFMHT
                    *****.**.**:::****::***:**:*****:** .* *:***************  **

4044|gene|nph       ARENHDITYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPHGSAKDPIRPLSMGLTSGASYV
3355|gene|hwa       ARENHDMTYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPHGSAKDPIRPLSMALNAGASYV
19210|gene|hbo      ARENHDITYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPHGSAKEPLRPLSMSLNAGASYV
1125|gene|nrc1      ARENHDITYIVFNNEVFGLTKGQTSPTSPKGHKSKTQPHGSAKSPIRPLSLSMTSGASYV
1862|gene|hhi       ARENHDITYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPHGSAKSPIRPLSQQLNAGATYI
890|gene|hla        ARENHDMAYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPSGSAKEPIKPLSMSLNAGASYV
2847|gene|hut       ARENHDMTYIVFNNEIFGLTKGQTSPTSPKGHKSKTQPSGSAKSPIRPLSLALTSGASYI
                    ******::*******:********************** ****.*:.***  :.:**:*:

4044|gene|nph       SRTAAVNPNQAQEILVEAIEHNGFSHIDFLTQCPTWNKDAKQYVPYIDVQQSDEYGFDHT
3355|gene|hwa       ARTAAVNPNQARDIIVEAIEHDGFSHIDFLTQCPTWNKDAKQYVPYIDINDSDEYDVDTT
19210|gene|hbo      ARTAAVNPNQAKDIIVEAIQHDGFSHVDFLTQCPTWNKDAKQYVPYIDINDSEDYDIDIS
1125|gene|nrc1      ARTAAVNPNQAKDILVEAIQHDGFAHVDFLTQCPTWNKDAKQYVPYVDVQESDEYDFDVT
1862|gene|hhi       ARTAAVNPNQAKEIIAEAIEHDGFAHIDFLTQCPTWNKDAKHYVPYTDVQQSDEFDFDVS
890|gene|hla        ARTAAVNPNQAKEILIEAIEHDGFAHVDFLTQCPTWNKDARQYVPYIDVNESDDYDFDKT
2847|gene|hut       ARTAAVNPNQAKEILVEAIEHDGFAHVDFLTQCPTWNKDAKQYVPYTDVQDSDDYDFDIT
                    :**********.:*: ***:*:**:*:*************.:**** *:::*:::..* :

4044|gene|nph       DRREASEMMYEAESALYEGEVLTGRFYHDDDRLSYGEEKRAVGEMPERPLAEQYHEDDYE
3355|gene|hwa       DRSTASQLMFETENALHEGTVLTGRYYVDNNRPSYQQEKKRTGEIPEEPLAEKYFDDEYE
19210|gene|hbo      DRKSAADMMYETEDALHEGTVLTGRYYHDEDRPSYQQEKRRIGEIPEESLAERYFDDEYE
1125|gene|nrc1      DRREAQELMTETEEALYDGTVLTGRYYQDEQRPSYQAEKQSRGDMPEEPVAKRYFDDDYE
1862|gene|hhi       DRAEAAEMMRKTEERLYEGEVLTGRMYIEDERPSYGEEKRQIGEMPEEPLAERYFDEDAE
890|gene|hla        DRVEAAEMMRETEESLYEGEVLTGRFYVDEDRQSYGAEKQAIGEMPEEPLAERYWDDDYE
2847|gene|hut       DRREAGEMMHEVEDKLYEGEILTGRFYVDEDRPSYTEEKQAIGEMPEEPLAEKYFDADAE
                    **  * ::* :.*. *::* :**** * :::* **  **.  *::** .:*:.* : : *

4044|gene|nph       WERSYD-LLDAHR
3355|gene|hwa       WDRVYDTFLDKHK
19210|gene|hbo      WERTHDLFLDKHK
1125|gene|nrc1      WERSFD-VIDRHK
1862|gene|hhi       WERTYDNLLEHHK
890|gene|hla        WERSHDKFLDKHA
2847|gene|hut       WDRSYD-LLERHT
                    *:* .* .:: *