HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0567COG2170arCOG02722Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0567 nrc1 VNG1397 vng1397 no entry
cHOG0567 hmu HMUK2239 Hmuk_2239 glutamate--cysteine ligase GCS2( EC:6.3.- )
cHOG0567 hma RRNAC0866 gcs2 carboxylate-amine ligase
cHOG0567 hwa HQ2566A gcs2 carboxylate-amine ligase
cHOG0567 hla HLAC0952 Hlac_952 glutamate--cysteine ligase GCS2
cHOG0567 hbo HBOR15450 Hbor_15450 uncharacterized enzyme( EC:6.3.- )
cHOG0567 hut HUTA0405 Huta_0405 glutamate--cysteine ligase GCS2
cHOG0567 hvo HVO_1668 HVO_1668 gamma-glutamylcysteine synthetase
cHOG0567 nph NP3372A carboxylate-amine ligase
cHOG0567 hhi 1504 gcs2 carboxylate-amine ligase/glutamate--cysteine ligase GCS2
MUSCLE (3.6) multiple sequence alignment


405|gene|hut        ME-TASESPFTELGTLGIEEEFFVVDEYGRPVSGTDTLVYN--SEPPAILENRLDHELFK
1397|chp|nrc1       MD-VGSPEAFSESGTLGVEEEFFVVDEHGVPTAGSDELVYE--GEPPEPIAGRLDHELFK
3372|gene|nph       MD-LGSREAFDRTGTLGIEEEFFVVDEYGRPTAGTDELVYE--NEPPEPLKDRLDHELFK
10866|gene|hma      MDATGSAEHFTRMGTLGIEEEFYVVDEFGRPTSGTDELVYE--TEPPAVLDGRLDHELFK
1504|gene|hhi       MDATGSAEHFTRMGTLGIEEEFYVVDEFGRPTSGTDELVYE--TEPPAVLDGRLDHELFK
2566|gene|hwa       MD-VGSADAFDRMGTLGVEEEFFVVDDSGQPTAGIQELIYDYNHPPAGVLADRLDHELFQ
952|gene|hla        ME-LGSRDAFARMETLGIEEEFYIVDADGRPTSGIDDLVYG--RDPPAEVPEGFDHELFK
15450|hp|hbo        ME-LGSADAFDRMGTLGVEEEFYIVDSDGYPASGISDLIYD--DPPEGLLGDRIDHELFK
                    *:  .* . *    ***:****::**  * *.:* . *:*     *   :   :*****:

405|gene|hut        FVIESQTPVIEDPGDAAATLSAVRGALVEHARDHGFEIAAAGLHPGARWRELEHAEKPRY
1397|chp|nrc1       FVVETQTPTLNGVAEAPAAIREVRAALVAYASEHGLRIAGAGLHPGARWREHEHAEKPRY
3372|gene|nph       CVIETQTPTIGSLSAADDALAEVRKALVSHAETHGFGIAAAGLHPAAKWRELDHAEKPRY
10866|gene|hma      CVIETQTPRIDDPANAGDHLRSVRDALVDHAEANGFGIAAAGLHPLAKWRELEHAEKPRY
1504|gene|hhi       CVIETQTPRIDDPADAGKHLRSVRDALVDHAEANGFGIAAAGLHPLAKWRELEHAEKPRY
2566|gene|hwa       FVIETQTPLLEDVSAVSESVQAVRDALVTHAADHGYRIAAAGLHPTAKWRERNHVEKPRY
952|gene|hla        CTIEAQTELIEDPSNAVDALSTVRAALVDHAAADGYRIAAAGLHPAAKWRELEHAEKPRY
15450|hp|hbo        FTVETQTPLIENPSEADELVRAVREALVSHAADHGYRIAAAGLHPAAKWRELDHATKPRY
                     .:*:**  : . . .   :  ** *** :*   *  **.***** *.*** :*. ****

405|gene|hut        RSQLDRIQYPQHRNTTAGLHVHVGVDDAEKAVWIANKIRWHLPIVLALAANSPYWNGFDT
1397|chp|nrc1       RSQLDRIQYPQHRNTTAGLHIHVGVDDPDKAVWVSNRMRWHMPVLLALSANSPYWNGFDT
3372|gene|nph       RAQLDRIQYPQHRNTTAGLHIHVGVDDADKAVWVANELRWYMPVMLALSANSPYWNGFDT
10866|gene|hma      KSQLDRIQYPQHRNTTAGLHVHVGVDDADKAVWVANELRWHLPLMLALSANSPYWNGFDT
1504|gene|hhi       KSQLDRIQYPQHRNTTAGLHVHVGVDDADKAVWVANELRWHLPLMLALSANSPYWNGFDT
2566|gene|hwa       QSQLDRIQYPQHRNTTAGLHVHVGVDDPDAATWIANELRWYLPPLLALSANSPYWNGFDT
952|gene|hla        QAQLDRIQYPQHRNTTAGLHVHVGVDDADKAVWIANRLRWHCPVLLALSANSPFWNGFDT
15450|hp|hbo        KSQLDRIQYPQHRNTTAGLHVHVGVDDPDKATWIANELRWYLPPLLALSANSPFWNGFDT
                    .:******************:******.: *.*::* :**: * :***:****:******

405|gene|hut        GLSSARAKLFEGLPNTGMPTTFDSFESFHRFEQRMIETDSISDRGELWFDVRPHTEYGTV
1397|chp|nrc1       GLASARAKIFEGLPNTGLPTAFESYAAFQAFERRMVEHGGIEDRGELWYDVRPHSGHGTV
3372|gene|nph       GLQSARAKIFEALPNTGMPTAFEDFESFQSFERTMVETGSINDRGELWYDVRPHSEHGTV
10866|gene|hma      GLQSARGKIFEALPNTGMPTTFDDYDAFETYEQRMLETGSIDDRGELWFDVRPHSGHGTV
1504|gene|hhi       GLQSARGKIFEGLPNTGMPTAFDDYDAFETYERRMLETGSIDDRGELWFDVRPHSGHGTV
2566|gene|hwa       GLASARAKIFEALPNTGMPTRFEDFEAYYQLEKRMVETGSIKDRGELWYDVRPHTGHGTV
952|gene|hla        GLASARAKIFENLPNTGIPSAFDDFDAFQRYERRMVERGSIADRGELWFDVRPHTGHGTV
15450|hp|hbo        GLSSARAKIFENLPNTGMPSRFEDFEAYQRFERRMVEHGSIEDRGELWYDVRPHTGHGTV
                    ** ***.*:** *****:*: *:.: ::   *. *:* ..* ******:*****: :***

405|gene|hut        EVRTADAQADIDRVLALVEYVHELVLDLAARYEDGETI---TAVRRELLDENKWRAIRHG
1397|chp|nrc1       EVRAPDAQADPAVVDAFVEYAHALVTEYAQRYDDHPDPFSVTGLRRELLDANKWRAMRDG
3372|gene|nph       EVRTPDGQADPDHVLAFVEYTQALVEDLSARYEDGESG---ANHRRELLDENKWRALRHG
10866|gene|hma      EVRAPDGQADPDRVLAFVEYVHELVVDLAERYEDGESG---RRLRREFLDENKWRAIRHG
1504|gene|hhi       EVRAPDGQADPDRVLAFVEYVRELVVDLAERYEDGESG---RRLRREFLDENKWRAIRHG
2566|gene|hwa       EVRTPDAQADPSVTVAIVEYIHALVMDFAARYADGESG---TKVRREILDANKWHAMRYG
952|gene|hla        EVRAPDAQRDPGVTLAFVEYVHALVVDYAERYADGESP---PTLRRELLDENKWRAIRHG
15450|hp|hbo        EVRTPDAQSDPEKTLAFVEYVHALVLDLAARYEDGESG---TTIRRELLDENKWRATRHG
                    ***:.*.* *   . *:*** . ** : : ** *          ***:** ***.* * *

405|gene|hut        REASFITRDGAETIDLMTAIERDRSRLDLDRLASLVAAESGATRQRRL-AEDSVDRLYSS
1397|chp|nrc1       HDASFVARETQGAVDLGTVVDRECDRLGVSGIRDVYDDVSGAQQQRRILDTHGEKRLYNH
3372|gene|nph       HDAELLDRSLEESVPLGELVESECQRLGVSGIRDVYEAESGAEKQRRLLESEGMDALCGS
10866|gene|hma      QSAELLSRDLSTTRSVEELVEIESDRLGVDGLWELYHRESGAERQRRLRSEEGVMALADS
1504|gene|hhi       QSAELILRDISTTRSVEELVEMESDRLGIDGLWELYDRESGAERQRRLRAEEGVMALADS
2566|gene|hwa       RDAEFIIPGSMETVTLSEFVDRETNRLGVDGLTTLLAREGGAKKQRRLHASDNIDTLLES
952|gene|hla        HDASFITRDGEDTVSLGEAVADECDRLGIDGIRDVYDAESGSQRQRRLREEGGLDALCDD
15450|hp|hbo        HDASFIALDGEGTVSLEQFVIEECDRLDVDGLKDIFDAESGAERQRRIHADESLDTLCNV
                    ..*.::      :  :   :  : .**.:. :  :    .*: .***:    .   *   

405|gene|hut        LLVEDPRRPSPR
1397|chp|nrc1       LSL---------
3372|gene|nph       LSVEWDSS----
10866|gene|hma      LRLS--------
1504|gene|hhi       LRLS--------
2566|gene|hwa       LCLDTDT-----
952|gene|hla        LMLSP-------
15450|hp|hbo        LCLN--------
                    * :