HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0566COG1697KOG2795arCOG04143DNA topoisomerase VI subunit ADNA topoisomerase VI subunit A

HOG Organism Gene ID Name Annotation
cHOG0566 nrc1 VNG0884 top6A DNA topoisomerase VI subunit A
cHOG0566 hmu HMUK2727 Hmuk_2727 DNA topoisomerase (ATP-hydrolyzing)( EC:5.99.1.3 )
cHOG0566 hma RRNAC0459 top6A DNA topoisomerase VI subunit A
cHOG0566 hwa HQ2654A top6A DNA topoisomerase VI subunit A
cHOG0566 hla HLAC1315 Hlac_1315 Spo11/DNA topoisomerase VI subunit A domain protein
cHOG0566 hbo HBOR16550 Hbor_16550 DNA topoisomerase VI, subunit A( EC:5.99.1.3 )
cHOG0566 hut HUTA0129 Huta_0129 DNA topoisomerase (ATP-hydrolyzing)
cHOG0566 hvo HVO_1570 HVO_1570 top6A Type II DNA topoisomerase VI subunit A.
cHOG0566 nph NP3480A top6A DNA topoisomerase VI subunit A
cHOG0566 hhi 1177 top6A DNA topoisomerase VI subunit A
MUSCLE (3.6) multiple sequence alignment


1315|gene|hla       ----MTTESD-----ARDELIDLAADFYDQFADGKIPEMKLPTRTKSNIEYDTESGVWTY
3480|gene|nph       MSSESDTDTE--DEIARERLIELASDFYDQFAEGEVPTMEIPTRTKSNIVFDEDKDVWVY
2654|gene|hwa       ----MSTKQD--EELAQERLIDLAAEFYDQFDSGDIPAMEIPTRTKTNIVFDEDSEVWVY
16550|gene|hbo      ----MSTNQN--DELAQERLIDLAVEFYDQFAEGDIPHMDIPTRTKSNIVFDEDSNVWVY
884|gene|nrc1       --MSETHTSD--ETEARDQLLAIAEQFYDQFADGDIPRMSLPTRSKSNIEYDEDADVWVY
129|gene|hut        MSTDTGNTEDASDGDARERLIELAAQFYDQFERGDVPHMDVPTRTKTNIEYDPEQKVWVY
10459|gene|hma      MSTDSDTTPD--TEEAREQLIDLAADFYDQFADGEVPTMTIPTRTKSNIVFDEDEQVWVY
1177|gene|hhi       MSTDSDTTPD--TEEAREQLIDLAADFYDQFADGEVPTMTIPTRTKSNIVFDEDEQVWVY
                             :     *.: *: :* :*****  *.:* * :***:*:** :* :  **.*

1315|gene|hla       GDRTSTRSANSVRGARKLLKAAYTIEFLADQLDEDRSSTLRELYYLSESWDNDEAQFKSQ
3480|gene|nph       GDRTSTRSANSVRGAQKLLKAIYTIEFLADQLEQGRSSTLRELYYLSESWDEERAQFNDQ
2654|gene|hwa       GDRTSTRSANSVRGARKLLKAAYTIEFLVDQLEEDRSSTLRELYYLSESWDNKEAQFSDQ
16550|gene|hbo      GDRKSTRSANSVRGARKLLKATYAIEFLVNQLEEGRSSTLRELYYLSESWDTEEAQFNDQ
884|gene|nrc1       GDSQSTRSANSVRGARKLLKSVYTVDFLAQQLDEGRSSTLRELYYLSESWDEAEAQFNDQ
129|gene|hut        GDRKSTRSSNSVRGAQKLLKVIYSIDFLANQLEEDRSSTLRELYYLSESWDLDEAQFNSQ
10459|gene|hma      GDRNSTRSAKTISGAEKILKAVYTIDFLSQQLEEDRSSTLRELYYLSESWDLDEAQFNTQ
1177|gene|hhi       GDRNSTRSAKTISGAEKILKAVYTIDFLSQQLEEDRSSTLRELYYLSESWDLDEAQFNTQ
                    **  ****:::: ** *:**  *:::** :**::.****************   ***. *

1315|gene|hla       DESNDLVEDLEIVTGVTREDFHMRPEESGATLMGPLLIREQTRRGEREIHCQEDVGTGGY
3480|gene|nph       DESNQLVEDLEIVSKVTREDFHMRPEESGATIMGPLYLREQTRRGEREIHCQKDVGEGGY
2654|gene|hwa       DESNQLVEDLEIVSKVTREDFHMRPEESGATLMGPLELREQTRRGERAIHCQEDVGEGGY
16550|gene|hbo      DESNQLIEDLEIVSNVTREDFHMRPEESGATLMGPLELREQTRRGEREIHCQEDVGEGGY
884|gene|nrc1       SESDKLVEDLEIVSGVKREDFHMRPEESGAKVMGPLRLREQTRRGDREIHCQEDVGQGGY
129|gene|hut        DESNQIIEDLEIVSDVRREEFHMRPEESGAKVMGPLRLREQTNRGDREIHCQDDVGQGGY
10459|gene|hma      DESNNLIEDLEIVSDVKREDFHMRPEESGAKVMGPLLLREQTNRGDREIHCQDDVGQGGY
1177|gene|hhi       DESNNLIEDLEIVSDVKREDFHMRPEESGAKVMGPLLLREQTNRGDREIHCQDDVGQGGY
                    .**:.::******: * **:**********.:**** :****.**:* ****.*** ***

1315|gene|hla       QIPNNPDMIEFLDDDIDFALAVETGGMRDRLVENGFDEAYNCLVIHLKGQPARATRRITK
3480|gene|nph       QIPNNPDTIEFLDNDADFVLCVETGGMRDRLVENGFDEEHNVIIVHLKGQPARATRRITK
2654|gene|hwa       QIPNNPDTIDFLDHDIDFVLCVETGGMRDRLIENGFDDMYNCLIVHLKGQPARATRRITK
16550|gene|hbo      QIPNNPDTIEFLDHDIDFVLCVETGGMRDRLIENGFDEEYGCLVVHLKGQPARATRRITK
884|gene|nrc1       QIPNNPDTIDFLDTDADFVLCVETGGMRDRLVENGFDDDYNAIVVHLGGQPARATRRLTK
129|gene|hut        QIPNDPDTIEFLDNDADFVLCVETGGMRDRLVENGFDDEYNALVVHLGGQPARATRRLTK
10459|gene|hma      QIPNNPDTIEFLDNDAKFVLCVETGGMRDRLVENGFDDEYDALVVHLGGQPARATRRLIK
1177|gene|hhi       QIPNNPDTIEFLDNDAKFVLCVETGGMRDRLVENGFDDEYDALVVHLGGQPARATRRLIK
                    ****:** *:*** * .*.*.**********:*****: :. :::** *********: *

1315|gene|hla       RVHDELDVPVAVFADGDPWSYRIYGSVAYGSIKSAHLSKYLATPEAQFVGIQPEDIVEYD
3480|gene|nph       RLHDDLDLPVVVFCDGDPWSYRIYASVAYGSIKSAHLSEYLATPEAEYIGIQPADIVEYD
2654|gene|hwa       RLHDELSVPVVVFTDGDPWSYRIYGSVAYGSIKSAHLSEYLATPEARFIGIQPTDIVEYE
16550|gene|hbo      RLHDELDLPVMVFTDGDPWSYRIYGSVAYGSIKSAHLSEYLATPEARFVGIQPQDIVDYD
884|gene|nrc1       RLHDELDLPVTVFTDGDPWSYRIYGSVAYGSIKSAHLSEYLATPQAQFIGIRPQDIVDYD
129|gene|hut        RLHDELDLPVTVFTDGDPWSYRIYGSVAYGSIKSAHLSKYLATPEAQFIGVQPEDIVEYD
10459|gene|hma      RLHDELDLPVTVFTDGDPWSYRIFGSVSYGSIKSAHLSEYLATPEAQFIGIRPEDIVEYE
1177|gene|hhi       RLHDELDLPVTVFTDGDPWSYRIFGSVSYGSIKSAHLSEYLATPEAQFIGIRPEDIVEYE
                    *:**:*.:** ** *********:.**:**********:*****:* ::*:.* ***:*:

1315|gene|hla       LPADPLADSDINALESELEDPRFQTDYWEEQIELQLDIGKKSEQQSLASRGLDFVTDTYL
3480|gene|nph       LPTDPLSDSDINALESELDDPRFQDDYWREQIELQLDIGKKAEQQALASRGLDFVTETYL
2654|gene|hwa       LPTDPLADSDVNALESELEDPRFQSEYWTEQIELQLDIEKKAEQQSLASRGLDFVTETYL
16550|gene|hbo      LPTDPLSDSDINALESELEDPRFMTDYWEEQIELQLDIEKKAEQQALASRGLDFVTDTYL
884|gene|nrc1       LPTDPLSDSDVNALESELEDPRFQSDFWTEQIGLQLDIDKKAEQQALASRGLDFVTDTYL
129|gene|hut        LPTDPLADSDINALESELEDPRFQTDYWEEQIELQLDIDKKSEQQALASYGLDFVTDTYL
10459|gene|hma      LPTDPLSDSDVNALESELEDPRFQTDFWEEQIELQLDINKKAEQQALASRGLDFVTETYL
1177|gene|hhi       LPTDPLSDSDVNALESELEDPRFQTDFWEEQIELQLDINKKAEQQALASRGLDFVTETYL
                    **:***:***:*******:****  ::* *** ***** **:***:*** ******:***

1315|gene|hla       PERLDAMGVI
3480|gene|nph       PERLGEMGVL
2654|gene|hwa       PERLDDMGVI
16550|gene|hbo      PERLDTMGVI
884|gene|nrc1       PERLAEMGVL
129|gene|hut        PERLEAMGIL
10459|gene|hma      PERLDEMGIL
1177|gene|hhi       PERLDEMGLL
                    ****  **::