HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0565COG0788arCOG02826Formyltetrahydrofolate hydrolaseformyltetrahydrofolate deformylase

HOG Organism Gene ID Name Annotation
cHOG0565 nrc1 VNG1946 purU formyltetrahydrofolate deformylase
cHOG0565 hmu HMUK1421 Hmuk_1421 formyl transferase domain protein( EC:3.5.1.10 )
cHOG0565 hma RRNAC3272 purU formyltetrahydrofolate deformylase
cHOG0565 hwa HQ3129A purU formyltetrahydrofolate deformylase
cHOG0565 hla HLAC1251 Hlac_1251 formyl transferase domain protein
cHOG0565 hbo HBOR06300 Hbor_06300 formyltetrahydrofolate deformylase( EC:3.5.1.10 )
cHOG0565 hut HUTA2219 Huta_2219 formyl transferase domain protein
cHOG0565 hvo HVO_2191 HVO_2191 purU Formyltetrahydrofolate deformylase
cHOG0565 nph NP5006A purU formyltetrahydrofolate deformylase
cHOG0565 hhi 516 purU formyltetrahydrofolate deformylase
MUSCLE (3.6) multiple sequence alignment


1946|gene|nrc1      MSSEQHSRSVAENDYTEVTVVGADRTGIVAAVTGLLFEHGANIEDVEQTVRDGVFRMTLL
1251|gene|hla       ----------MTRELTEITVVGGDKTGLIARVTSLLFERGINIEDLDQAVRGGVFRMTTR
3129|gene|hwa       ----------MTGELTEITVVGDDKTGIVANITTLLFERGINIVDIDQAIREGMFRMTLR
6300|gene|hbo       -----------MTDLTEITVIGGDKTGLIANVTTLLFERGINVEDLDQAVRDGIFRMTLH
5006|gene|nph       -------MAAVTREYTEITVVGDDDTGLIARVTTLLFERDINIEDLDQAVREGIFRMTMS
2219|gene|hut       ----------MTREFTEITVVGDDETGLIANVTSLLFERGVNIEDLDQAVREGVFRMTTM
13272|gene|hma      --------------------------------------------------------MTMR
516|gene|hhi        -------MGIVTRGLTEITVVGEDDTGLIAEVTSLLFERSINIEDLDQAVREGVFRMTMR
                                                                            **  

1946|gene|nrc1      ADCGFADGADPVTDRAAFQAALDDTGDELGVDVRVRFPDERD-DGIAVLVTKEDHCLRAL
1251|gene|hla       VDA-----SEMETSRGELRRALAELGRELDVDIQVRFPSDRDARRIALLVTKETHAPEAL
3129|gene|hwa       ADI-----DEMVCTESTLRETLTELGDDLEVDIQIRFPTDRETKRIAVFVTKESHCLQAL
6300|gene|hbo       ADT-----SEMVCTEETLRDALHDLGDDLGVDVQVRFPSDRDTQQIAVLATKESHCLEAL
5006|gene|nph       VDT-----AGMSCTESELRTALSELGDELGVDIQVRFPADRETRTIAVLVTKESHCLEAL
2219|gene|hut       VDT-----SEMIVTEETLRNDLQDLAAELDVDITVRFPKDRETQSIAVLVTKESHCLEAI
13272|gene|hma      VDT-----SGMVTTEEKLREDLTELGDALGVDVQVRFPADRETQTIAVLVTKESHCLEAL
516|gene|hhi        VDT-----SEMVTTEEKLREDLTELGDELGVDVQVRFPSDRETQTIAVLVTKESHCLEAL
                    .*               :.  * : .  * **: :*** :*:   **::.*** *.  *:

1946|gene|nrc1      LEA----DLG-----APVNVVIGNHDTLEAVADEHDVPFHDIGDDTGTPDEERLLELLAA
1251|gene|hla       LEAEAAGDLADDGEEAEIPVVVGNRGDLRSLAERYDKPFYDVGDGNGNTDEERLLDLLAE
3129|gene|hwa       LEAHATGELD-----AELSVVIGNHGNLEPLVTQYEIPFVDIGDDSGIPDEDQVLSVLDE
6300|gene|hbo       FEAWANGDLD-----ADISVVIGNRDHLRPLAERYDVPFYNVGDEKGSPDEDELLDLLDE
5006|gene|nph       FEAWADGELG-----ADISVIIGNHDDLEPLADHYGVDFYNIGDEKGTPDEERLLELLDD
2219|gene|hut       FEAWASGNLG-----ADVEVVIGNHPDLQPLAEKYEVPFHDIGDEKGTPDEDELLDLLAE
13272|gene|hma      FEAWANGDLG-----ADIEVVIGNHDDLEPLAAKYDVPFHDIGDEKGTPDEDQLLDLLAQ
516|gene|hhi        FEAWANGDLG-----ADIEVVIGNHDDLEPLAAKYDVPFHDIGDEKGTPDEDQLLDLLAQ
                    :**    :*      * : *::**.  * .:.  :   * ::** .* .**: :*.:*  

1946|gene|nrc1      YDTDLVVLARYMRILSPDVVFRYAGHIVNVHPSLLPAFPGAQAYRQAVEAGVRVAGVTAH
1251|gene|hla       YDVDLIVLARYMRILSPEVVFRYEGRIINVHPSLLPAFPGAEAYRQAKDAGVRVAGVTAH
3129|gene|hwa       YQIDLAVLARYMRILSPKIVFRYEDRIINVHPSLLPSFPGAAAYRQAKEEGVRIAGVTAH
6300|gene|hbo       YDADLVVLARYMRILSPNVVFRYEDRIINIHPSLLPAFPGAAAYRQAKEEGVRIAGVTAH
5006|gene|nph       YDTDLIVLARYMRILSPNVVFRYEDRIINIHPSLLPAFPGAEAYRQAREEGVRIAGVTAH
2219|gene|hut       YDTDLIVLARYMRILSPDVVFRYENRIINVHPSLLPSFPGASAYMQAIEEGVRIAGVTAH
13272|gene|hma      YDADLIALARYMRILSPDVVFRYESRIINVHPSLLPAFPGASAYMQAIEEGVRIAGVTAH
516|gene|hhi        YDADLIALARYMRILSPDVVFRYESRIINVHPSLLPAFPGASAYMQAIEEGVRIAGVTAH
                    *: ** .**********.:**** ..*:*:******:**** ** ** : ***:******

1946|gene|nrc1      YVTTDLDQGPILTQRAFTVPPNASVAAVKDRGQPLEADALVAAVRAHLAGDTTVRRGAVA
1251|gene|hla       YVTTDLDQGPVIAQRAFDVPPGADVAEIKRRGQPLEADVLLNAVRLHLADAIAIHRGTVH
3129|gene|hwa       YVTTDLDQGPIITQRAFDVPDDADVETIRNRGQPLEADALLEAIELHLDNTISVHRGRTG
6300|gene|hbo       YVTTDLDQGPIITQRAFDVPDDASLEEIKSLGQPLEADALLEAVQLHLDDAVSVHRGRTS
5006|gene|nph       YVTTDLDQGPIITQRAFNAPAGASTEELERRGQPLEAEALLEAVQLHLDNATHVYHGRTE
2219|gene|hut       YVTTDLDQGPVITQRVFNVPPEATEEELQEIGQPLEAEALLDAIDLHLNDEIYVHRGRTR
13272|gene|hma      YVTTDLDQGPIITQRAFNVPDDATEEELQQIGQPLEAEALIEAIKLHLDDEVNVHRGRTK
516|gene|hhi        YVTTDLDQGPIITQRAFNVPDDATEEELQQIGQPLEAEALIEAIKLHLNDEVNVHRGRTK
                    **********:::**.* .*  *    :   ******:.*: *:  ** .   : .* . 

1946|gene|nrc1      VDGPHEYGA----------------------L--------ADD-----------------
1251|gene|hla       VREDTTVDA-QLGLSEAAVDANPDEPVDGEPLSQSGASTAESD-----------------
3129|gene|hwa       LHSGTDSSEYQLGLPKDIEAIQPDDPIDT--HESDTDTTSEPVSDVVND-----------
6300|gene|hbo       LRPGADDADYQLGMTDEATAANPDRPIDG--L---ADALQADVGVADGGTVDDGASTDEE
5006|gene|nph       LRDDVDTDDYQLGLPESFDEMVPDRPVDG--L---GEAVSGDD-----------------
2219|gene|hut       LREPEETDA-QLGAPKELDDLNPDRPIDG--L---GEIVSEGE-----------------
13272|gene|hma      LRDPEETSA-QLGAPEKLDQLNPDRPIDG--L---GEFVAGDD-ELEADD----------
516|gene|hhi        LRDPEETSA-QLGAPEKLDQLNPDRPIDG--L---GEFVAEDDGEIEADD----------
                    :                                                           

1946|gene|nrc1      -----------------------------
1251|gene|hla       -----------------------------
3129|gene|hwa       -----------------------------
6300|gene|hbo       EQREAEAADSDTPESNEDEAEAAPNPSDD
5006|gene|nph       -----------------------------
2219|gene|hut       -----------------------------
13272|gene|hma      -----------------------------
516|gene|hhi        -----------------------------