HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0564COG0185KOG0899 KOG0898arCOG04099Ribosomal protein S1930S ribosomal protein S19P

HOG Organism Gene ID Name Annotation
cHOG0564 nrc1 VNG1693 rps19p 30S ribosomal protein S19P
cHOG0564 hmu HMUK1832 Hmuk_1832 ribosomal protein S19
cHOG0564 hma RRNAC1607 rps19p 30S ribosomal protein S19P
cHOG0564 hwa HQ2838A rps19p 30S ribosomal protein S19P
cHOG0564 hla HLAC2445 Hlac_2445 ribosomal protein S19
cHOG0564 hbo HBOR10270 Hbor_10270 SSU ribosomal protein S19P
cHOG0564 hut HUTA2296 Huta_2296 ribosomal protein S19
cHOG0564 hvo HVO_2560 HVO_2560 rpsS ribosomal protein S19
cHOG0564 nph NP4862A rps19p 30S ribosomal protein S19P
cHOG0564 hhi 2150 rps19p 30S ribosomal protein S19P
MUSCLE (3.6) multiple sequence alignment


2445|gene|hla       -MSSDYRTGREGKEFAYRGHSLDELQEMDVDEVAELLPARQRRSIVRGLGTEQQKLLEKV
1693|gene|nrc1      -MSTEYRTGREG-EFTYRGHDLDELQEMSLEDVAELLPARQRRTITRGLSEEHHKVLAEA
11607|gene|hma      -MSSEYQIGHEG-EFSFRGHTLDELQEMELEEVAELLPARQRRSIVRGLTEEKHKLLEKA
2150|gene|hhi       -MSSEYQIGHEG-EFSFRGHTLDELQEMELEEVAELLPARQRRSIVRGLTEEKHKLLEKA
2296|gene|hut       MSSHDYQIGHEG-EFTYRGHTLEELQDMSVEEVAELLPARMRRSIKRGLSYEKRQLLEEA
4862|gene|nph       -MSSEYQIGHEG-EFTYRGHTLDELQEMELDEVAELLPARQRRTIKRGLSVEQEKLLDEA
2838|gene|hwa       -MSSEYRTGREG-EFTYRGHTLDELQAMSLEDITALLPARQRRTIERGLTTEQQKLRETV
10270|gene|hbo      -MSSEYRTGREGEEFTYRGYTLDELQEMELDEVVELLPARQRRSINRGLTLQKEKLLETV
                      * :*. *.** **::**: *:*** *.::::. ***** **:* ***  :: ::   .

2445|gene|hla       RSRDKETTADNPIRTHLRDMPILPEFVGVTFSVYNGHSFERVQVEPEMIGHFLGEFHLTR
1693|gene|nrc1      RESGTEETANNPIRTHLRDMPVLPEFVGLTFAVYTGQEFERVEVQPEMIGHYLGEFQLTR
11607|gene|hma      REAGEEETANDPIRTHLRDMPVVPEMVGLTFAVHDGQNFERVKVEPEMLGHYLGEFQLTR
2150|gene|hhi       REAGEEETANDPIRTHLRDMPVVPEMVGLTFAVHDGQNFERVKVEPEMLGHYLGEFQLTR
2296|gene|hut       RDAGEEETANDPIRTHLRDMPILPEFVGITFAVHNGQSFERVKVEPEMLGHYLGEFQLTR
4862|gene|nph       REAGEEETANNPIRTHLRDMPILPRFVGLTFAVYNGQSFERVEVEPEMIGHYLGEFQLTR
2838|gene|hwa       RDADPQKTANDPIRTHLRDMPILPSFVEKTIAVYNGQSFERVRIEPEMIGHYLGEFQLTR
10270|gene|hbo      READPEETANSPIRTHLRDMPILPSFVDKTFAVYNGQSFERVRIQPEMVGHYLGEFQLTR
                    *. . : **:.**********::* :*  *::*: *:.**** ::***:**:****:***

2445|gene|hla       STVEHGQAGIGATRSSKFVPLK
1693|gene|nrc1      SSVEHGQAGIGATRSSKFVPLK
11607|gene|hma      SSVEHGQAGIGATRSSKFVPLK
2150|gene|hhi       SSVEHGQAGIGATRSSKFVPLK
2296|gene|hut       TSVEHGQAGIGATRSSKFVPLK
4862|gene|nph       TSVEHGQAGIGATRSSKFVPLK
2838|gene|hwa       TSVEHGQAGIGATRSSKFVPLK
10270|gene|hbo      NSVEHGQAGIGATRSSKFVPLK
                    .:********************