HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0562COG0652KOG0885 KOG0865 KOG0879 KOG0880 KOG0881 KOG0883arCOG04767Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familypeptidyl-prolyl isomerase

HOG Organism Gene ID Name Annotation
cHOG0562 nrc1 VNG1914 ppiA peptidyl-prolyl isomerase
cHOG0562 hmu HMUK1591 Hmuk_1591 Peptidylprolyl isomerase( EC:5.2.1.8,EC:5.2.1.8 )
cHOG0562 hma RRNAC3303 ppiB1 peptidyl-prolyl cis-trans isomerase
cHOG0562 hwa HQ3123A ppiA peptidylprolyl isomerase
cHOG0562 hla HLAC1668 Hlac_1668 peptidyl-prolyl cis-trans isomerase cyclophilin type
cHOG0562 hbo HBOR06580 Hbor_06580 peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family( EC:5.2.1.8,EC:5.2.1.8 )
cHOG0562 hut HUTA1852 Huta_1852 Peptidylprolyl isomerase
cHOG0562 hvo HVO_2222 HVO_2222 ppiA peptidyl-prolyl cis-trans isomerase slr1251
cHOG0562 nph NP3056A ppiA peptidylprolyl isomerase
cHOG0562 hhi 541 ppiB peptidyl-prolyl cis-trans isomerase
MUSCLE (3.6) multiple sequence alignment


1852|gene|hut       ----------------------------------MGDLTATLETTHGDIEIELYDERVPT
13303|gene|hma      MAAMASLQYVNPRSVGRLFCRASLRL-------SMSDLTATLHTTEGEIEVELYDERVPT
541|gene|hhi        ----------------------------------MSDLTATLHTTEGEIEVELYDERVPT
3056|gene|nph       -----------------MSDDASVSD--------PENPTATIATTHGDITVELFEQRAPR
3123|gene|hwa       -----------------MAVDPDVAN--------EQNPLITLETTRGDITLELFEQRAPQ
6580|gene|hbo       ----------------------------------MSNPTATLHTTRGDITVELFEERAPR
1914|gene|nrc1      ------------------MRRADCRN--------TMPVDATVHTSEGEFDIELYDERAPR
1668|gene|hla       --------------MGRVFRRALLRRDMAREVSNPDNPQVTLHTNHGDVVVELFADRAPK
                                                            *: *. *:. :**: :*.* 

1852|gene|hut       TVQNFVNLAEHDPA-ADAEPAPETPTWEDPETGETRGDAFYQDTPIHRIIDGFMVQMGDP
13303|gene|hma      TVENFVGLAEGADDYDGTEVGPGTGAWEDPESSEKRIDPLYTDIDIHRIIENFMIQMGDP
541|gene|hhi        TVENFVGLAEGADDYDGTEVGPGTGAWEDPESGEKRIDPLYTDIDIHRIIEDFMIQMGDP
3056|gene|nph       TVENFIGLATGANDYEGTDIEPGTGAWEDPETGEKRIDPLYDDVPFHRVIEDFMIQGGDP
3123|gene|hwa       TVENFLGLATGEKE------------WSDPDTGETRTDSLYEGTIFHRIIPEFMIQGGDP
6580|gene|hbo       TVENFIDLATGEKE------------WEDPETGETRTDSLYEGTIFHRIIDDFMIQGGDP
1914|gene|nrc1      TVENFLNLARHEPA-ADADPAPDTVTWEDPESGEIRGDSLYAGVSFHRIIEGFMIQGGDP
1668|gene|hla       TVENFLGLARHDPA-ADADPARDTNTWEDPESGEVRGDSLYEGNVFHRVIEDFMIQGGDP
                    **:**:.**                 *.**::.* * *.:* .  :**:*  **:* ***

1852|gene|hut       TGTGRGGPGYTFDDEFDSDLGHDGPGVVSMANSGPNTNGSQFFITFDAQPHLDGDHAVFG
13303|gene|hma      TGTGRGGPGYSFDDEFHDELSHDGPGVLSMANSGPNTNGSQFFITLDAQPHLDGKHAVFG
541|gene|hhi        TGTGRGGPGYSFDDEFHDELSHDGPGVLSMANSGPNTNGSQFFITLDAQPHLDGKHAVFG
3056|gene|nph       TGTGRGGPGYQFDDEFHDELSHDGPGILSMANSGPDTNGSQFFITLDAQPHLDGRHAVFG
3123|gene|hwa       EGTGRGGPGYTFDDEFHEDLNHDGAGILSMANRGPNTNGSQFFITLDSQPHLNGKHAVFG
6580|gene|hbo       EGTGRGGPGYTFDDEFHDELRHDSAGKLSMANRGPDTNGSQFFITLGAQPHLDDRHAVFG
1914|gene|nrc1      TGTGRGGPGYEFADEFHDDLTHDGPGVLSMANSGPDTNGSQFFITLDAQPHLDGRHAVFG
1668|gene|hla       QESGRGGPGYQFDDEFHDDLTHDGPGILSMANSGPNTNGSQFFITLDATPHLDGKHAVFG
                      :******* * *** .:* **..* :**** **:*********:.: ***:. *****

1852|gene|hut       EVIDGMDTLEALENVDTGPRDEPEEDVRLEAVRIND
13303|gene|hma      KVIDGMDVVESIGSVDTDRNDAPTEEMLLESVDVHR
541|gene|hhi        KVIDGMEVVESIGSVDTDRNDAPTEEMLLESVEIHR
3056|gene|nph       QVIDGMDVVEEVGSLPTGRNDDPQEDVSIESVDVDQ
3123|gene|hwa       HVVEGMDTVEDIASVPTDRDDKPMQDIEIEALNIER
6580|gene|hbo       EVVEGMDVVEEIGSLPTDRNDKPMKDVEIESIDIDR
1914|gene|nrc1      AVTDGMDVVETIGDVETDANDAPASEITIDRVEIHE
1668|gene|hla       QVIDGMDVVEEIGAVPTDRRDEPRDTVEIEQITVEE
                     * :**:.:* :  : *.  * * . : :: : :