HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0561COG0071KOG0710arCOG01835Molecular chaperone (small heat shock protein)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0561 nrc1 VNG1771 vng1771 no entry
cHOG0561 hmu HMUK1607 Hmuk_1607 heat shock protein Hsp20
cHOG0561 hma RRNAC1703 Hsp20
cHOG0561 hwa HQ3346A hsp20 hsp20 type chaperone
cHOG0561 hla HLAC2382 Hlac_2382 ABC-1 domain protein
cHOG0561 hbo HBOR07180 Hbor_07180 molecular chaperone (small heat shock protein)
cHOG0561 hut HUTA2583 Huta_2583 heat shock protein Hsp20
cHOG0561 hvo HVO_2303 HVO_2303 Hsp20
cHOG0561 nph NP1744A hsp20_3 hsp20-type chaperone
cHOG0561 hhi 2237 hsp20 heat shock protein Hsp20
MUSCLE (3.6) multiple sequence alignment


2382|gene|hla       MVTLVNLRAYWRFFVVMRRFSPLIVAYWRDRKRYFLFGGGREVDAETQRERAAILLDILL
1771|chp|nrc1       ---------------------------------------------------MSRLRDALG
2583|gene|hut       ---------------------------------------------------MSALRDALS
1744|gene|nph       ----------------------------------------------------MQLREALD
11703|gene|hma      ---------------------------------------------------MSALREALR
2237|gene|hhi       ---------------------------------------------------MPALREALR
3346|gene|hwa       ----------------------------------------------MLNICMSPLRDALQ
7180|gene|hbo       ---------------------------------------------------MSALRDALQ
                                                                          * : * 

2382|gene|hla       TLGPTFIKLGQILSTRPDILPPAYIDVLEGLQDDVPPAPWEESKIVLEDELGPVDETFDD
1771|chp|nrc1       NL--------------PDAV---FVDVHEG----------ADAYRYVVDVAGVTPSTVD-
2583|gene|hut       DL--------------PDAV---FADLLES----------ESAYLLVIDVPGATGETVD-
1744|gene|nph       EL--------------PETV---FADLLER----------EDAYLLVIDLPGATADTVD-
11703|gene|hma      DL--------------PDAV---FADVLES----------EDEYLLVLDLPGVTAETID-
2237|gene|hhi       DL--------------PDAV---FADVLES----------EDEYLLVLDLPGVTADTID-
3346|gene|hwa       EL--------------PSAV---FADLLES----------ADAYLVVLDLPGVTADTTT-
7180|gene|hbo       EL--------------PDAV---FADLLES----------DDAYLLVLDLPGVTPDTVE-
                     *              *. :   : *: *            .    : *  * . .*   

2382|gene|hla       FDREPISGASLGQVYTARYEGSDVAVKVRRPKIESLVEADLRTIRWSIPLVRKFTGSGRA
1771|chp|nrc1       ----------------VSVAGRTVSIEAHRRK----------------------------
2583|gene|hut       ----------------ARTEGNRLDIEARRAK----------------------------
1744|gene|nph       ----------------VQLEDGCLSISARREK----------------------------
11703|gene|hma      ----------------VTVEGGRLRIDGQRTK----------------------------
2237|gene|hhi       ----------------VTVEGGRLRIDGQRTK----------------------------
3346|gene|hwa       ----------------LSVDRGRLSVEARREK----------------------------
7180|gene|hbo       ----------------VRVEKGRLVIEARRDK----------------------------
                                           : :. .* *                            

2382|gene|hla       FSLENLADEFAKTIREEMDYNRERAMLEEIRANFADEDRIRIPT--AFEAVSGPRVLTME
1771|chp|nrc1       ----------------------------------------SVPS--AFEYRREDRSLFVD
2583|gene|hut       ----------------------------------------DVPT--DFEYVSEERSLFLD
1744|gene|nph       ----------------------------------------SVPR--SFEYLTEERSLFLD
11703|gene|hma      ----------------------------------------DVPG--EFTFVREDRSVFLD
2237|gene|hhi       ----------------------------------------DVPG--EFTFVREDRSVFLD
3346|gene|hwa       ----------------------------------------DLPSDEDFRYIREERSLFLD
7180|gene|hbo       ----------------------------------------QLPP--EFRYVREDRSLFLD
                                                             :*    *      * : ::

2382|gene|hla       YIPGTKISDVDALDDAGHDRNAIAETLQDVYLQMIIDDGVFHADPHPGNLAVDDDGAVIF
1771|chp|nrc1       ------------------------------------------------------------
2583|gene|hut       ------------------------------------------------------------
1744|gene|nph       ------------------------------------------------------------
11703|gene|hma      ------------------------------------------------------------
2237|gene|hhi       ------------------------------------------------------------
3346|gene|hwa       ------------------------------------------------------------
7180|gene|hbo       ------------------------------------------------------------
                                                                                

2382|gene|hla       YDFGMAGRVDPFIQEKIVDFYVAVARQDIDGILDTLIAMGTLSPEADREVMGNVMELAIA
1771|chp|nrc1       ------------------------------------------------------------
2583|gene|hut       ------------------------------------------------------------
1744|gene|nph       ------------------------------------------------------------
11703|gene|hma      ------------------------------------------------------------
2237|gene|hhi       ------------------------------------------------------------
3346|gene|hwa       ------------------------------------------------------------
7180|gene|hbo       ------------------------------------------------------------
                                                                                

2382|gene|hla       DASGEDIEQYQVNQIIEQVESTIYEFPLRLPPDLALVLRVATVVEGVCVTLDPEFDFIST
1771|chp|nrc1       -----------------------AELPL--PSD---------------------------
2583|gene|hut       -----------------------VELPL--PPD---------------------------
1744|gene|nph       -----------------------IEVPL--PPD---------------------------
11703|gene|hma      -----------------------AELPL--PPD---------------------------
2237|gene|hhi       -----------------------AELPL--PPD---------------------------
3346|gene|hwa       -----------------------VDLPL--PPD---------------------------
7180|gene|hbo       -----------------------AEIPL--PPD---------------------------
                                            :.**  *.*                           

2382|gene|hla       ATEYLKEEGYYEQTARNLAEGAGQQAQKTAEALFTVPPKADDFLDRANRGDLHIDVTIDD
1771|chp|nrc1       ------------------TTADGATATVSNGVLTVSLPKRSSS-DH------HVPVEG--
2583|gene|hut       ------------------VEADGISGTVDRGVLELTLPKMTETATE------SIPIEDA-
1744|gene|nph       ------------------ATGTDAAGEIERGVLELTLPKADGADET------TIPVE---
11703|gene|hma      ------------------TTGQGGEGTVENGVLELRLPKATAAPST------TIPIDGD-
2237|gene|hhi       ------------------TTGQGGEGTVENGVLELRLPKATAAPST------TIPIDGD-
3346|gene|hwa       ------------------ATGSGASAEMDRGVLEITLPKRDAAPDQ------TIPISSPE
7180|gene|hbo       ------------------ATGAGADSEIDRGVLTIRLPKRDAAPER------TIPVTSAD
                                      . . .  .     .*    **              : :    

2382|gene|hla       GSNVLDKLAMRIAYSVLLAVGVLSSTILYSFAQSWRLAAVVLLLAAPLAVALYRSFRKKR
1771|chp|nrc1       ------------------------------------------------------------
2583|gene|hut       ------------------------------------------------------------
1744|gene|nph       ------------------------------------------------------------
11703|gene|hma      ------------------------------------------------------------
2237|gene|hhi       ------------------------------------------------------------
3346|gene|hwa       GA----------------------------------------------------------
7180|gene|hbo       DTEA--------------------------------------------------------
                                                                                

2382|gene|hla       GIRTTPQFTRQGMKKRRDD
1771|chp|nrc1       -------------------
2583|gene|hut       -------------------
1744|gene|nph       -------------------
11703|gene|hma      -------------------
2237|gene|hhi       -------------------
3346|gene|hwa       -------------------
7180|gene|hbo       -------------------