HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0560COG0094KOG0398 KOG0397arCOG04092Ribosomal protein L550S ribosomal protein L5P

HOG Organism Gene ID Name Annotation
cHOG0560 nrc1 VNG1705 rpl5p 50S ribosomal protein L5P
cHOG0560 hmu HMUK1841 Hmuk_1841 ribosomal protein L5
cHOG0560 hma RRNAC1598 rpl5p 50S ribosomal protein L5P
cHOG0560 hwa HQ2829A rpl5p 50S ribosomal protein L5P
cHOG0560 hla HLAC2436 Hlac_2436 ribosomal protein L5
cHOG0560 hbo HBOR10360 Hbor_10360 LSU ribosomal protein L5P
cHOG0560 hut HUTA2305 Huta_2305 ribosomal protein L5
cHOG0560 hvo HVO_2551 HVO_2551 rpl5p ribosomal protein L5.
cHOG0560 nph NP4880A rpl5p 50S ribosomal protein L5P
cHOG0560 hhi 2141 rpl5p 50S ribosomal protein L5P
MUSCLE (3.6) multiple sequence alignment


1705|gene|nrc1      -MSETDS-TDFHEMREPRIEKVVVHMGVGQGGVELQNAETILEAITGQQTVRTKAKSPEP
11598|gene|hma      MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVG
2141|gene|hhi       MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQTPVRTKAKRTVG
2305|gene|hut       MSSESRD-ADFHDMREPSVEKVVVHMGIGQGGQELADAEEILEEIVGQQPVRTTAKATVG
2829|gene|hwa       -MSETDS--TFHEMREPQLEKVVVHMAVGEGGRELANAEEILQEIAGQTAVRTTATRAAS
2436|gene|hla       -MSESES--ASHEMREPYLEKVVVHMGVGQGGEPLADAEEIIEEITDQQSVRTTSKRTIA
10360|gene|hbo      -MSESEV--VSHEMREPQIEKVVVHMGVGEGGRELANAEEILEEITGQQSVQTIATRAAT
4880|gene|nph       MSSEPDA-GEFHEMREPTVEKVVVHMGVGRGGEPLAQAEEILEEIVEQQPVRTTAQKTIQ
                      **.      *:**** :*******.:* **  * :** *:  *. * .*.* :  .  

1705|gene|nrc1      EFGLRQGDPIGAKVTLRDDTAVDFLERALPAADLDRRQFDNTGNVSFGIEEHTDFPSQEY
11598|gene|hma      EFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEY
2141|gene|hhi       EFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEY
2305|gene|hut       EFDIRQGDPVGTKVTLRDEAAEEFIETALAFTDLDAAQFDETGNFSFGVEEHTDFPSQEY
2829|gene|hwa       QFGAREGDPIGAKVTLRGADAQSFLEKALPLVTISERQFDETGNFSFGVEEHTTFPSQEY
2436|gene|hla       EFGIRKGDPIGVKVTLRGEDAHAFLDTALELADISKSQFDDTGNLSFGVEDHTDFPSQEY
10360|gene|hbo      QFGARKGDPIGAKVTLRGDKAVEFLETALPLADISAKQFDETGNFSFGVEEHTEFPSQEY
4880|gene|nph       DFEVREGDPIGTKATLRGEDAEEFLETALPLADIDRKQFDETGNFSFGVEEHTEFPSQEY
                    :*  *:***:*.*.***.  *  *:: **  . :   ***:***.***:*:** ******

1705|gene|nrc1      DPNIGIYGMDVTVNLTRPGYRVAKRDQGTRQIPSNHRLNSEDAVSFLVSNFDVEVNE---
11598|gene|hma      DPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE---
2141|gene|hhi       DPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE---
2305|gene|hut       DPTIGIYGLDVTVNLTRPGYRVAKRDKASRPIPSNHRLDPQDAIAFVESTFDVEVSQ---
2829|gene|hwa       DPQIGIYGLDVTVNLTRPGYRVTKRDKASQPIPSRHRLTPSDAVQFIESEFTVDITRVSA
2436|gene|hla       DPNIGIYGLDVTTTIVRPGYRVSKRDKATASIPSKHRMTAEDATAFLETNFDVEVTE---
10360|gene|hbo      DPQIGIYGLDVTVNLVRPGYRVKKRDKASRSIPSAHRMSAEDATAFLEANFDVEVAEE--
4880|gene|nph       DPQIGIYGLDVTVNLVRPGYRVHKRDKVSRSIPSNHRLTAEDAVTFLESNFDVEVSE---
                    ** *****:***..:.****** ***: :  **: **: . **  *: : : *::     

1705|gene|nrc1      --------
11598|gene|hma      --------
2141|gene|hhi       --------
2305|gene|hut       --------
2829|gene|hwa       DTRDGGDN
2436|gene|hla       --------
10360|gene|hbo      --------
4880|gene|nph       --------