HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0556COG0565arCOG01018rRNA methylasesimilar to SpoU-family rRNA methylase

HOG Organism Gene ID Name Annotation
cHOG0556 nrc1 VNG1347 spoU similar to SpoU-family rRNA methylase
cHOG0556 hmu HMUK2774 Hmuk_2774 RNA methyltransferase, TrmH family, group 1
cHOG0556 hma RRNAC0018 trmH RNA methyltransferase
cHOG0556 hwa HQ2467A tRNA/rRNA methyltransferase
cHOG0556 hla HLAC1382 Hlac_1382 RNA methyltransferase, TrmH family, group 1
cHOG0556 hbo HBOR14320 Hbor_14320 RNA methyltransferase, TrmH family, group 1
cHOG0556 hut HUTA2656 Huta_2656 RNA methyltransferase, TrmH family, group 1
cHOG0556 hvo HVO_2906 HVO_2906 RNA methyltransferase TrmH family group 1
cHOG0556 nph NP3772A tRNA/rRNA methyltransferase
cHOG0556 hhi 781 trmH TrmH family RNA methyltransferase
MUSCLE (3.6) multiple sequence alignment


1347|chp|nrc1       -----MTWTSTPTTRPAMS------------------KPAVAIVDAETAGNVGTIARAMK
2467|gene|hwa       --------------MPEAA-----------------HNFVVVVVEPETPGNIGTIARAMK
1382|gene|hla       MSGVDEGDETDRTEDPTHAGTDADAGANTDPDPQTRRKPVVVVVEPETPGNVGTIARAMK
14320|gene|hbo      --------------MPRHS------------------KPVVVVVEPETPGNVGTIARAMK
3772|gene|nph       --------------MP---------------------NIAVAVVGAETPGNVGTIARSMK
2656|gene|hut       ------------------------------------MNVSVAVVDAQTPGNVGTIARAMK
10018|gene|hma      -------------------------------------MISVAVVDAETPGNVGTIARSMK
781|gene|hhi        -------------------------------------MISVAVVDAETPGNVGTIARSMK
                                                            *.:* .:*.**:*****:**

1347|chp|nrc1       NFGFEELLLVDPPYLGRDSEAYGFAGHAREDILPEARELSFDALVSEFHTVGFTAITNED
2467|gene|hwa       NFGLTELLLVDPPPIPAGSEAYGFAGHAREDVLPNAKTVSFDAVVNKYHTIGTTAITAED
1382|gene|hla       NFGLSDLKLVDPPELKEDGEAYGFAGHAREDVLPNADEVTFDEIVANYHTVGTTAITGED
14320|gene|hbo      NFGLTDLKLVNPPPLEPDGEAYGFAGHAREDVLPNADEVTFDEVVEEYHTVATTAITNED
3772|gene|nph       NFGLSELYLVDPPELDPDGEAYGFAGHAREDVLPNATEVEFSYLTEQFYTVACTATTNED
2656|gene|hut       NFGLSDLKLVDPPELDPDGEAYGYAGQARDDIMPSADVVTFEEIVNNYHTVATTAITNED
10018|gene|hma      NFGLSELLLVDPPELDPDGEAYGFAGQARDDILPNARTVTFDDIVENYHTVACTATTNED
781|gene|hhi        NFGLSELLLVDPPELDPDGEAYGFAGQARDDILPNARTVTFDEIVENYHTVACTATTNED
                    ***: :* **:** :  ..****:**:**:*::*.*  : *. :. :::*:. ** * **

1347|chp|nrc1       ATSHTRFPFRTPAELGDSLRDVEAPTALVFGRERVGLTNDELARIDEVGSIPASDDYPVM
2467|gene|hwa       SRHHVRFPYKTPAEISDDLKTVETETALVFGREGTGLTNDELTSLDEVCSIPANESYPVL
1382|gene|hla       DQSHERFPFKTPVELRESLKTVDAPTAIVFGREGRGLNNEELSQLDEVCSIPADDDYPVL
14320|gene|hbo      SRKHVRFPYKTPVEVRESLETVETKTALVFGREGRGLNNDELARLDEICSIPASDDYPVL
3772|gene|nph       ATKHVRYPFIEPAALSDELAGLDADVCIVFGRERVGLTNDELAQLDRICSIPADGDYPVL
2656|gene|hut       ATKHVRYPFVTPRELGEELKGIDSDVCLVFGREDVGLSNEELAEVDQICSIPASDDYPVL
10018|gene|hma      PANHVRYPATTPADLADSLQDVEGDICVVFGRERVGLSNDELARLDVICSIPASASYPVL
781|gene|hhi        PANHVRYPATTPADLADSLQDVEGDICVVFGRERVGLSNDELARLDVVCSIPASASYPVL
                       * *:*   *  : :.*  ::   .:*****  **.*:**: :* : ****. .***:

1347|chp|nrc1       NLGQSATVALYELRDLAMSETQLPDVERHRADEAEIEQFYEHASEFLDAVDYPAEKQAKT
2467|gene|hwa       NLGQAATVLLYELRSLTLTDTQLPDVERERADESDIDRFYEFFTDFLHSVEGREHKREKT
1382|gene|hla       NLGQAATVLLYELRDLTVDETQLPDTAVTRAPEPDVERFHEFFGDFLEATGQREHHRDKN
14320|gene|hbo      NLGQAATILMYELRSLTVDETQLPDVERERATESEIERFYDNFENFLEHAEHRDHKRPKT
3772|gene|nph       NLAQAATIVLYELRELTVEETQHPKQAHERADEHEIEGLHETFSEYLHEVGHPEEKIPKT
2656|gene|hut       NLGQAATIVLYELRALTVEETQLPEIT-DRADQPAIEGLHDQFGSFLEVIDHPEEKRAKA
10018|gene|hma      NLGQAATIVLYELRELTVDETQHPEQLHTLAETPAVEGLHEEFDRFLGAIGHPEEKQHKA
781|gene|hhi        NLGQAATIVLYELRELTVDETQHPEQLHTLAATPAVEGLHEEFDRFLGAIGHPEEKQHKA
                    **.*:**: :**** *:: :** *.     *    :: :::    :*        :  * 

1347|chp|nrc1       MRMLRRMLGRTHPTGREINTVHGLLRRA-----------------------ETQLPEDD-
2467|gene|hwa       ALMLRRLIARAHPTNREISTLLGLFRRANILLGEQSYGESNQTDEMDDTTAVESIPEESI
1382|gene|hla       ALLVRRLLGRAHPTEREIHSLLGTFRKANVKL--------EHADHLAAKYDEPVYPRE--
14320|gene|hbo      MRMIRRLIGRAHPTDREVHTLTGLFRRA--------------------TNRFDRYEDETR
3772|gene|nph       ERLFRRLAGRASPTGREARTLRGVLRRGALVASGEIPRPGTSDPGDEPNQKDESNRENE-
2656|gene|hut       GRLFRRVIGRAHPTGREVRTLRGLFRRV-----------------------EQKLED---
10018|gene|hma      RRLFRRVLGRAQPTGRETKTLRGLFRQA--------------------RQRIERAEDD--
781|gene|hhi        RRLFRRVLGRAQPTGRETKTLRGLFRQA--------------------RQRIERAEDD--
                      :.**: .*: ** **  :: * :*.                                 

1347|chp|nrc1       ------------------------------------------------------------
2467|gene|hwa       NAIIESTSSGYEETEAQTSSDGSLCDQSDSADLMNADEDTEMTAGADVDTDTDVETNTNN
1382|gene|hla       ------------------------------------------------------------
14320|gene|hbo      D-----------------------------------------------------------
3772|gene|nph       ------------------------------------------------------------
2656|gene|hut       ------------------------------------------------------------
10018|gene|hma      ------------------------------------------------------------
781|gene|hhi        ------------------------------------------------------------
                                                                                

1347|chp|nrc1       ---
2467|gene|hwa       DNT
1382|gene|hla       ---
14320|gene|hbo      ---
3772|gene|nph       ---
2656|gene|hut       ---
10018|gene|hma      ---
781|gene|hhi        ---