HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0554COG0125KOG3327arCOG01891Thymidylate kinasethymidylate kinase

HOG Organism Gene ID Name Annotation
cHOG0554 nrc1 VNG1929 tmk thymidylate kinase
cHOG0554 hmu HMUK1411 Hmuk_1411 thymidylate kinase( EC:2.7.4.9 )
cHOG0554 hma RRNAC3286 tdk thymidylate kinase
cHOG0554 hwa HQ3145A tdk thymidylate kinase
cHOG0554 hla HLAC1888 Hlac_1888 thymidylate kinase
cHOG0554 hbo HBOR06440 Hbor_06440 thymidylate kinase( EC:2.7.4.9 )
cHOG0554 hut HUTA1298 Huta_1298 thymidylate kinase
cHOG0554 hvo HVO_2207 HVO_2207 tmk thymidylate kinase
cHOG0554 nph NP2478A tdk thymidylate kinase
cHOG0554 hhi 525 tdk thymidylate kinase
MUSCLE (3.6) multiple sequence alignment


3145|gene|hwa       MHASPSIYTRMSTLITLEGLDGSGKSTVCESLQ----SALPEVTFTREPTDSWYGDLVTE
1929|gene|nrc1      ------------MLVTLEGLDGSGKTTVWESLRA---SHDDGVTFTAEPTDSQYGQAVRR
2478|gene|nph       ------------MLITLEGIDGSGKSTAHAALRER--LTAEETTFTREPTDSWYGSAVER
13286|gene|hma      ------------MLVTLEGLDGSGKTTVWERLRSDD-AVPSETVFTREPTDTWYGDAVQR
525|gene|hhi        ------------MLVTLEGLDGSGKTTVWERLQSDD-AVPSEAVFTREPTDTWYGDAVQR
1298|gene|hut       ------------MLITLEGIDGSGKSSAWESLREHAADLDPDFTFTREPTESWYGEAVQR
1888|gene|hla       ------------MLITLEGLDGSGKTTVWEALH----DVYPDATFTREPTDSWYGEAVDR
6440|gene|hbo       ------------MLITLEGLDGSGKTTAWEALH----DVYPDAVFTREPTESWYGDAVYR
                                 *:****:*****::.   *.          .** ***::.**. *  

3145|gene|hwa       SMHDDSADSLAELFLFTADHAAHLNRVIRPSLASGTAVISDRYADSRFAYQAAALA--DS
1929|gene|nrc1      SESAADADPIAELFLFTADHADHLSRVVSPALDRGDVVISDRYSDSRYAYQGATL---AD
2478|gene|nph       SIGDADADPLAELFLYTADHADHLSRVVRPALEAGEPVVSDRYSDSRYAYQGATL---EG
13286|gene|hma      SIDNDDADSLAELFLYTADHAAHLSETVRPALNEGRLVVSDRYSDSRYAYQGATLAG-SG
525|gene|hhi        SIDDDGADSLAELFLYTADHAAHLSNTVRPALDEDRLVVSDRYSDSRYAYQGATLEA-SE
1298|gene|hut       SIQEDDADSLAELFLYTADHAAHLANTVQPALDRGEVVVSDRYSDSRYAYQGATL---ED
1888|gene|hla       SIAADDADPLAELFLLTADHADHLSGTIEPALADGDLVISDRYSDSRFAYQAATLAASDV
6440|gene|hbo       SMSDEDADSLAELFLFTADHADHLSRVVRPALADDKLVISDRYSDSRFAYQAATLE--DA
                    *    .**.:***** ***** **  .: *:*  .  *:****:***:***.*:*     

3145|gene|hwa       RIDAPLEYIQSIHEPFSRRPDATVYLDIDPETGVTRAGATNKFERVQYLERVATQYERVI
1929|gene|nrc1      TVPRAMEYVRGIHQPWTRPPDVTLYFDVDPDTGAARSGATNKFETAAFLADVRANYEQLI
2478|gene|nph       VIDEPMAYVKRVHEPFTRPPDATLYFDVPPTVGAERAGATNKFEAADYLESVRENYERLI
13286|gene|hma      TFDDPLSYVREVHAPWTRPPDRTVYLDLDPETAARRSGATNKFETAEYLTTVRDNYERLI
525|gene|hhi        TFDDPLSYVREVHAPWTRPPDRTVYLDLDPETAAQRSGATNKFETADYLSTVRDNYERLI
1298|gene|hut       RLDDPLAFVREIHEPWTRPPDATIYLDVDAETGAERSGGTNKFERVEHLRAVRANYERLI
1888|gene|hla       DIDRPLEYIKGIHAAFSRPPDATIYLDLDAREAAERAGRTNKFEQDGYLAAVRKNYERLI
6440|gene|hbo       DLRRPLDYIRGIHAAFSRPPDATIFLDVDPETAAARAGATNKFERASYLREVKANYERLI
                     .  .: ::. :* .::* ** *:::*: .  .. *:* *****   .*  *  :**.:*

3145|gene|hwa       AAEPTRFYRVDASQSIADVKKRVKTIVGTMLGDEVSTES
1929|gene|nrc1      DYTPERFVRIDATQSPEAVIADAEAALADALPDDAWA--
2478|gene|nph       EAEPERFHRIDATQSESAVVEAAVETVETLLSR------
13286|gene|hma      EADPERFVRVDATADPDTVYERVRAAILD----------
525|gene|hhi        DADPARFVRVDATADPDTVYERVRAAIFD----------
1298|gene|hut       DDDPDRFVRIDATRAAEAVRADVFDAVERLLSEQ-----
1888|gene|hla       DAEPDRFVRIDASQSPEAVIARVEEVLSELLGE------
6440|gene|hbo       DAEPERFVRIDATQPPEDVVEMVERSVERLLSEHERR--
                       * ** *:**:     *   .   :