HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0553arCOG04770hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0553 nrc1 VNG0488 vng488 no entry
tucHOG0553 hmu HMUK2851 Hmuk_2851 conserved hypothetical protein
tucHOG0553 hma RRNAC3332 hypothetical protein
tucHOG0553 hwa HQ2642A hypothetical protein
tucHOG0553 hla HLAC0679 Hlac_679 hypothetical protein
tucHOG0553 hbo HBOR16330 Hbor_16330 hypothetical protein
tucHOG0553 hut HUTA2951 Huta_2951 conserved hypothetical protein
tucHOG0553 hvo HVO_1587 HVO_1587 putative acetyl-CoA synthetase
tucHOG0553 nph NP0602A hypothetical protein
tucHOG0553 hhi 572 HAH_0572 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2951|chp|hut      ----------------------MDGAVIGDLTAPSRRSDDLAYRVADDRARSHTYDSVCS
13332|hp|hma      ------------------------MQVLGDLVAQARDRDGVLFR-SPERAAPYSYSDFAT
572|hp|hhi        -MEEATYIGFVAALFFIGGAERRHMQVLGDLVAQARDRDGVLFR-SPERSTPYSYSDFAT
488|hp|nrc1       ------------------------METVADVVATLDDPAQPVLR----HARPMDARTTRN
679|hp|hla        ------------------------MDVVGDLLARDRRSRDIALV-T-ADGRERTYRDLIT
602|hp|nph        ------------------------MDVLGDIIGRDRRTDAPALV-APAVGRDYDYRRFCT
2642|hp|hwa       MNNNPGDLSESDTIGDDPPARVTDPAIIGDIMDRNRRNGTIALR-ADAADRYYTYRDFIT
16330|hp|hbo      ---------------------MADPAVVGDLVARDRRTSAPALR-ADASGRSYSYYDFVT
                                             :.*:                            .

2951|chp|hut      TAWKTANLLRLYGVHEGSTVGVVDAPKHPAADPGVTPQRTGETPIPEVIFTFLGAACLGA
13332|hp|hma      NAWKGGNLLRHYGVRHGTRVAVVVGPKEPTDEDRPGYLRDA----PDALLAFLAAALDGA
572|hp|hhi        NAWKGGNLLRHYGVRHGTRVAVVVGPKEPTDEDQPGYLRDG----PDALLAFLAAALDGA
488|hp|nrc1       RVYKTGNALRHRGVRVDAGVAILDAPT------------------PEAVQTFLGASLLGA
679|hp|hla        NAYKAANVLRYLGAREGSTVAVEPTPG------------------LHTTLAFLGAAGLGA
602|hp|nph        TAWKTGNFLRHLGVRGGAGVAVADDPL------------------PEPVLTLYGAALLGG
2642|hp|hwa       TSYKSGNVIRYLGGRSGDEILLVPDPL------------------PEPVLAFYGAAQLGI
16330|hp|hbo      TSYKAGNVLRYLGVRGGDEVAVAPDFL------------------PEPLLTFYGAAQLGA
                    :* .* :*  * . .  : :                            :: .*:  * 

2951|chp|hut      TVRFDPSPALE------ADALVGPAAWMDHYDSGPTCTSIAYGGPPENPSIVHFETEVWS
13332|hp|hma      VVDMDPPNAVD------ATALVAPAAWLDRYTQGPGTKGLAYGGPVDDPTIAQFERELWS
572|hp|hhi        VVDMDPPNAVD------ATALIAPAAWLDRYTQGPGTKGLAYGGPVDDPTIAQFERELWS
488|hp|nrc1       TVAFGPEPVVD------ARVLAGPTADLGAYDLPAGGQRVGWGEPPADPSWMYFERDVWS
679|hp|hla        PVRFDPVAGIE----QGDRVVLVAVADESTTEPAPGTNLATFGGPPNRPETTHWEQELWS
602|hp|nph        VVSFGPPSELD-----SPRAIVAPAADIDAEAVEPGTKPVAYGDDPGDPTVAYFERDVWS
2642|hp|hwa       VTRFDKTIQLDHSTEELPRVVLAPSTQEEAYELPPGHNLAVYGDSPTETETTHWETEVWS
16330|hp|hbo      VTVFDADISSL------PRATVVGVERESEFDLPPGHKLAVYGGAPERPDTTHWEKEVWS
                   . :.              .              .      :*     .    :* ::**

2951|chp|hut      ETPIAPPETVEPGVAVLVSDDRAFDHRQLLDAAELFIDQQGLTADDSVAVAASLSEPGTV
13332|hp|hma      ENPLQPPGEVAPDDAVLAAD-RTYTHGELMAESGRVVADYDIDAETTVALRAPMTTAGAV
572|hp|hhi        ENPLQPPGEVAPEDNVLAAD-RTYTHGELMAESGRVVADYDIGAETTVALRAPMTTAGAI
488|hp|nrc1       ENPAFPEPEIDADTTLLAAGGA--THREVVAAAERVASER-YDSHDAVAVRAPLSDPGTV
679|hp|hla        ENPGMPPSTVGPADPLVRGADGDVSHGGALDAAATVVDEYGVDSETRIVLRTSLADPRAL
602|hp|nph        ENPTEPPDHIAGTDPLLRAGEERYSHGDVLTAARTAIDDHGIDDGTTVAVGGSFRSPGVV
2642|hp|hwa       ENPAIHPTSVAPSDIALNADTQTYTHEELITAAVRVVDRVNITPGADVVVRESLMNPHVV
16330|hp|hbo      ENPAVHPADVSPADTVLRADGQTYTHADLLDAAVAVVDEYGIGVGDEVVVRDSFARPSVV
                  *.*      :      : .      *   :  :              :.:  .:  . .:

2951|chp|hut      VGGILAPLAVGGTILV----------GRDEETIRI----GGDGI-DPESIHLDG----
13332|hp|hma      VVGLLAPMRTGATVVF---------GGNETADIAV----ADRDAPEETVVRPDDATPS
572|hp|hhi        VAGLLAPMRAGATVVF---------GGDETGDIAV----ADGDAPEETVVRPDDTTPS
488|hp|nrc1       VAGVVAPLLAGATVVLP--------PEGGEGTVAVAAA-DADAVPEADVVSPGSAAPN
679|hp|hla        SAAVLAPLSVGGTTVLADAKSDGHGDDSARGDLAVVADDTTDAVPEPKTMALSEIVVR
602|hp|nph        AAGLVAPIVAGGTVAV---------GPAPEGDVQV----G----GEGSDVETDALL--
2642|hp|hwa       VAGLIAPLLAGATIVFP--------DETTTGEIGV----STDTVPEPKQIDLNSIW--
16330|hp|hbo      VSGLLAPILAGSVLVFP--------DEETVGDVAV----GEG--PEERRVDLAGVL--
                    .::**: .*..  .                : :          :   :