HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0549COG0042KOG2335 KOG2333 KOG2334arCOG00605tRNA-dihydrouridine synthasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0549 nrc1 VNG1431 vng1431 no entry
cHOG0549 hmu HMUK2582 Hmuk_2582 conserved hypothetical protein( EC:1.3.1.2 )
cHOG0549 hma RRNAC0052 dpd dihydropyrimidine dehydrogenase
cHOG0549 hwa HQ3013A tRNA-dihydrouridine synthase
cHOG0549 hla HLAC2335 Hlac_2335 hypothetical protein
cHOG0549 hbo HBOR11110 Hbor_11110 tRNA-dihydrouridine synthase( EC:1.3.1.2 )
cHOG0549 hut HUTA0763 Huta_0763 dihydropyrimidine dehydrogenase
cHOG0549 hvo HVO_2478 HVO_2478 dihydropyrimidine dehydrogenase
cHOG0549 nph NP2026A hypothetical protein
cHOG0549 hhi 811 dpd dihydropyrimidine dehydrogenase (NADP+)
MUSCLE (3.6) multiple sequence alignment


3013|gene|hwa       -------MFTPRVALASLSGEADATWAENGASDAGAAFIGGISLDTVTRDAARQLV-DRG
2335|hp|hla         MTASGDESPPPFLVAASLSGAADADWARAAAPHADAAILGGIAVDPASRAAARDLV-ARD
1431|chp|nrc1       ---------------------------MSAGEHAGGVFLGGIAIDEPTREAARAMV-DRD
11110|gene|hbo      ------MMFDPRVALASLSGEADAAWARQAESHAGMAFLGGISLDDRSRKAARELV-ARD
763|gene|hut        MSGVEPLPFEPRVAAASLSGESDVEWAKATIPHVGAAFLGGLAIDEPTRAAARKMVEDRD
2026|hp|nph         -------MFAPRLAVASLSGESDADWAAAAAPHVGCAFLGGLAIDAETRRAAAALA-ERD
10052|gene|hma      -------MFEPRVALASLSGEADASWARAVESHVGCAFLGGIALDDRTREAARAMT-DRD
811|gene|hhi        -------MFEPRLALASLSGEADASWARTVESHVGCAFLGGIALDDRTREAARAMT-DRD
                                                     .. .::**:::*  :* **  :.  *.

3013|gene|hwa       RCEFLPSDPIAFITTELDALADVAITPGVNVRSTTPEPVRVAGRHCAKYNAILEINAHCR
2335|hp|hla         RSEFLPADPLAWIDRELDQLSEAPIRPGVNVRSATVEPVREAAAVCAERDAVCEVNAHCR
1431|chp|nrc1       REEFLPADPVAWVDDQLSELDDAFLRPAVNVRAVRLGPLRDVAAVCAAHDAILEVNAHCR
11110|gene|hbo      RNEFLPEDPFAFVASELDTLADADIDAAMNVRSATVGPVRRAARICADRNAILEVNAHCR
763|gene|hut        REEFLPANPFAFADEQLNRLADEPLVAGLNVRSASREPLERIAESCADHGAICELNAHCR
2026|hp|nph         RTEFLPDDPIAFIDKQLAALAGTPVRPAFNVRSATVDPIVEAAAVCADRDAIVELNAHCR
10052|gene|hma      RSEFLPDDPVAFVDDQLAALADAPLCPAFNVRSATLGPVERAAAVCQRHDAIIEINAHCR
811|gene|hhi        RSEFLPDDPVAFVDDQLGALADTPLRPAFNVRSATLGPVERVAAVCQRHDAIIEINAHCR
                    * **** :*.*:   :*  *    : ...***:.   *:   .  *   .*: *:*****

3013|gene|hwa       QDEMCTVGAGETLLQDNESQLRELIKAGRAGGAMVSVKVRAGIDGVDLTAIARTIADAGG
2335|hp|hla         QSELRAVGCGESLLRDID-RLAEYVAAVAETGATTSVKVRAEVPGVDLVAVTDAVADAGA
1431|chp|nrc1       QDELCDAGAGETLLRDTS-RLCEQVRAASDEGAAVSVKVRAGVQGVHLPVLAQAIERAGA
11110|gene|hbo      QDELCAVGCGETLLRDTD-RLCEYVAAAADEGATVSVKVRAEIEGVSLETTADRVADAGA
763|gene|hut        QDEMCETGAGEALLAEPD-RLAKQVETAADAGATVSVKVRTEIDGVDLLAVARRIEAAGA
2026|hp|nph         QSEMCAAGAGESLLKDDD-RLCEQVRAAADTGATVSVKVRTEVDGVDLPALAAALSAAGA
10052|gene|hma      QDEMCAAGAGESLLREPD-RLAAFVEAAASTGATVSVKGRAELDGVSLPAVAQAIEDAGG
811|gene|hhi        QDEMCAAGAGEALLREPE-RLAAFVETAASTGATVSVKGRAELDGVSLPAVAQAIEDAGG
                    *.*:  .*.**:** : . .*   : :    ** .*** *: : ** * . :  :  **.

3013|gene|hwa       EIIHVDAMDTEVSIKQIATA---------APELFIIANNGVRGHESVREYYGYGADAVSI
2335|hp|hla         DWLHVDAMDSEGIVDELTAGRATDETGSPRDDLTVIANNGVRGRETVAEYAAYGADAVSV
1431|chp|nrc1       AAIHVDAMDSRRVVRDVAD----------ATALFVVANNGVRTRDDVFEYLSYGADAVSV
11110|gene|hbo      SILHVDAMDSEEVIADVSD-----------SSLFVVANNEVRGEASVREYLGYGADAVSV
763|gene|hut        DAVHVDAMDSEGVVAEIVA----------ATDLFVIANNGVRDRETVREYLACGADAVSV
2026|hp|nph         SVLHVDAMDSEHVVGAVTEA---------APNAFVVANNGVRDRKTTREYLDYGADAVSV
10052|gene|hma      DVFHVDAMDSESVIADVAD----------ATDLFVVANNGVRGTATTREYLSYGADAVSV
811|gene|hhi        DLFHVDAMDSESVVADVAD----------ATDLFVVANNGVRGRETAREYLSYGADAVSV
                      .******:   :  :                 ::*** **    . **   ******:

3013|gene|hwa       GRPSTNRHVRRQVRCAAEDIFETSNTDMQRSHIQQ---
2335|hp|hla         GRPSERPASLSRIADAVSAWREGELPEESEASLPEAQP
1431|chp|nrc1       GRPSRDPERVRAVYAAVKEWLL----------------
11110|gene|hbo      GRPSTDPRVLRRVRAAVDDWFDDETGASGEISEVGP--
763|gene|hut        GRPSDRPAVLKRVRNATEGWFESAETATREATQ-----
2026|hp|nph         GRPSDDPALLARVRRAVDEWFDSQRQTEVSADG-----
10052|gene|hma      GRASDKPETLDTVREATVEWFASEVSP-----------
811|gene|hhi        GRASDKPETLDEIRATTAEWFALEVPL-----------
                    **.*        :  :.