HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0548COG0167KOG1436arCOG00603Dihydroorotate dehydrogenasedihydroorotate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0548 nrc1 VNG2507 pyrD dihydroorotate dehydrogenase
cHOG0548 hmu HMUK0662 Hmuk_0662 dihydroorotate dehydrogenase( EC:1.3.3.1 )
cHOG0548 hma RRNAC2969 pyrD dihydroorotate dehydrogenase 2
cHOG0548 hwa HQ1052A pyrD dihydroorotate dehydrogenase 2
cHOG0548 hla HLAC0019 Hlac_19 dihydroorotate dehydrogenase
cHOG0548 hbo HBOR03140 Hbor_03140 dihydroorotate oxidase A /dihydroorotate oxidase B, catalytic subunit (EC 1.3.3.1)( EC:1.3.3.1 )
cHOG0548 hut HUTA1678 Huta_1678 dihydroorotate dehydrogenase
cHOG0548 hvo HVO_2943 HVO_2943 pyrD dihydroorotate oxidase
cHOG0548 nph NP0428A pyrD dihydroorotate dehydrogenase 2
cHOG0548 hhi 229 pyrD dihydroorotate dehydrogenase 2
cHOG0548 hhi 4256 HAH_4256 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4256|hp|hhi         ------------------------------------------------------------
1052|gene|hwa       ------MVIKQLYRAFRPLLFALPPETAHRLVHTGLETVQQTPIEHGFSNQFRVDNDRLQ
2507|gene|nrc1      -----------MYGLLKSALFGLPPETTHEITTSALRVAQRVGAHRAYAKQFTVTDPRLS
3140|gene|hbo       --------MRLLYRILKPALFSLPPETAHGLVHHGLRTVQHTPIEDALATRYRVEDDRLH
19|gene|hla         MPVRDETETMGAYDLLKPALFGLPPETAHGLTHRLLRAVQTTPVTEHLHSRFSVNDPRLR
428|gene|nph        ---------MGLYQLLKPALFQLDAETAHGLGHRVLDGIQGTPLERIVADYCTVVDPRLR
1678|gene|hut       ---------MNPYNLTKPLLFQLSPETAHALAHEGMKLVDGTPIESALARAFKVDDDRLS
12969|gene|hma      ---------MRPYDIAKPFLFSLPAETANKSVHRLLETVDGTRVADVMADRYTVADERLA
229|gene|hhi        ---------MRPYDIAKPLLFSLPAETANRSVHRLLEAVDGTRVAEAMADRYTVADDRLA
                                                                                

4256|hp|hhi         ---------------------------MTALGGGSVLQKGLSSSS-------KLRRLVDA
1052|gene|hwa       VEEFGQSFDNPIGVAAGFDKNAELPAILGALGFGHVEVGGVTAVSQSGNMRPRMFRLVE-
2507|gene|nrc1      VDAFGQTFPNPVGMAAGFDKNAEIPRALAGLGFGHIEVGAVTAERQPGNDRPRLFRLPD-
3140|gene|hbo       TEAFGCSFDNPVGVAAGFDKNAEVPDVLGSLGFGHVEVGGVTAEPQDGNARPRMFRLPE-
19|gene|hla         VEAFGNEFPNPVGVAAGFDKNAEVPRGLAALGFGHVEVGGVTAEQQPGNPRPRLFRLRE-
428|gene|nph        VDAFGQTFPNPVGVAAGFDKNAEIPDALGALGFGHVEVGGVTAEPQAGNPRPRMFRLAE-
1678|gene|hut       MSAFGCEFPNPIGVAAGFDKTAEAPGTLGALGFGHVEVGGVTAEPQEGNPRPRVFRLVE-
12969|gene|hma      VEAFGHTFDNPVGVAAGFDKNATIPETLASLGFGFAEVGGVTAEPQAGNARPRMFRLKA-
229|gene|hhi        VEAFDQTFDNPVGVAAGFDKNATIPGALASLGFGFAEVGGVTAEPQAGNARPRMFRLRE-
                                               : .** *     .:::         .: **   

4256|hp|hhi         ADSAVPSRVPNGVKPTALRRAGKVDDSVPDADV----PTG-----RMSAKLNDMPG----
1052|gene|hwa       -DEALINRM--GLNNEGADVIGERLSSHRR-EIDHCGPVGVNIALSESTPTDEAPADYQY
2507|gene|nrc1      -DNALVNRM--GFNNEGADTVGARLDAEPLPDV----PVGVNIGKSKTTPLADAPDDYTY
3140|gene|hbo       -DGAIINRM--GLNNEGADAVGARLAAGPRADI----PVGVNLALSESTDAEDAPADYRY
19|gene|hla         -DEALINRM--GFNNEGADIVGERLDREPLPEI----PVGINIGKSKSTPLAEAPEDYLY
428|gene|nph        -DRALINRM--GFNNDGADIVGERLAATDC-RV----PVGVNIGKSKSAANDDAEADYQY
1678|gene|hut       -DEAIINRM--GLNNPGAKVIGERLDNTDV-SM----PVGVNLAKTEDVPMDEAAADYRE
12969|gene|hma      -DEAIINRM--GLNNDGAIVIGERLKNVDAPF-----PVGVNIAKTEHVGTNEAPDDYRT
229|gene|hhi        -DEAIINRM--GLNNDGAIVIGERLKNVDAPF-----PVGVNIAKTEHVGTSEAPDDYRT
                     * *: .*:  *.:  .    *               *.*        .   :       

4256|hp|hhi         ---------------------------PKRQRTTEQFDQLDTDGSDYL---GNTDINDPT
1052|gene|hwa       TYEQIAEGADYVAVNVSCPNSEGMQDLQQRDSLSRIMDALTNAGAETVLVKLAPELSLSA
2507|gene|nrc1      TFSRVGDAVDYVVVNVSSPNTPGLRELQGRDQLAAILEALQDAGASPLLVKLSPDLHQDA
3140|gene|hbo       TYEQVADAADYVAVNVSCPNSEGFRDLQNRDSLEAILGGLVDAGADPLLVKLSPDLPDPA
19|gene|hla         TYERVADAGDYFVVNVSSPNTPGLRELQNRAALEEILGTLTDAGADPLLVKLSPDLPEPA
428|gene|nph        TYERVADGGDYFVVNVSSPNTPGLRELQSRDRLESILGTLQDDGASPLLVKLSPDLTDAA
1678|gene|hut       TYEQVAEGGDFFVINVSCPNSPGFRELQNRESLEDIFSTVKNAGAAPLLVKLSPDLPEPA
12969|gene|hma      TYEHVAEGGDFFVVNVSCPNSEGFEELQNRDAMEAILSELQDAGAAPLLVKLSPDLPEPA
229|gene|hhi        TYERVAEGGDFFVVNVSCPNSEGFEELQNRDAMEAILSELQDAGAAPLLVKLSPDLPEPA
                                                 *      :  :   *:  :     .::   :

4256|hp|hhi         LK-ATDLFENTGPSGRRALN-------DLAESDQDAADALL--QMDDAATQR-RFV-RAY
1052|gene|hwa       IEDVIDLVDIFDLDGIITTNTTTERPENLESTKQTERGGLSGAPIEDHATKLVQLVAKRT
2507|gene|nrc1      VADAVELANDLGLDGIVATNTTTERPESLSHPHAGEQGGLSGAPIRERATEQVRFVAERT
3140|gene|hbo       VEDALDVVNEYGLDGVVATNTTTDRPAELQNPNRAERGGLSGAPIEERATEMVRFVAERT
19|gene|hla         VEDALGVVDDLGLDGVIATNTTTSRPNSLKSPQQAERGGLSGKPIEPIATERVRFVAERT
428|gene|nph        IEDAIEVVEDLGLDGIIATNTTTKRPASLHSDAADEEGGLSGAPITDESTDIVRFIAKRT
1678|gene|hut       VEETLELVEEYDLDGVIATNTTTDRPEALTSPDRVEEGGLSGRPIEEQATEMVRFVASRT
12969|gene|hma      VEDALDLVTELDLDGVVATNTTTERPASLRSPNAVETGGLSGKPIENQATEMVRFVAERV
229|gene|hhi        VEDALDLVTELDLDGVVATNTTTERPASLRSPNAVETGGLSGKPIENQATEMVRFVAERV
                    :  .  :    . .*  : *        *        ..*    :   :*.  .::    

4256|hp|hhi         ESGEVDSDELTTALRRYDELDANEKRT--ADAMVMRGG------DDG-VSLLDEQVCNSP
1052|gene|hwa       DVPIIGVGGVSDAAGAYAKIRAGASLVQLYTGLVYQGPTLARDINMGLLQLLEDDGFDSI
2507|gene|nrc1      DQPVVGVGGVATAEDAYEKIRAGASVVQLYTALVYEGPWVAKRINEGLVSLLERDGFDSV
3140|gene|hbo       DVPVVGVGGVASAEDAYAKIRAGASLVQLYTGLVFEGPTLTRDINEGLLTLLERDGFDSI
19|gene|hla         DVPVIGVGGISDAKGAYEKIRAGASLIQLYTGLVYEGPGLARDINGGVLDLLDRDGFDSV
428|gene|nph        DKPIVGVGGIDDAESAYEKIRNGASVVQLYTGLVYEGPTIARDINRGLLKLLERDGFASV
1678|gene|hut       DVPVVGVGGVFTAADAYRKIRAGASLVQIYTGFIYRGPTIARNVNRGLATLLERDGFDSV
12969|gene|hma      DVPVVGVGGVSTAEGAYRKIRAGASLVQLYTGLVYRGPSIAREINSGLRDLLAEDGFDSV
229|gene|hhi        DVPVVGVGGVSTAEGAYRKIRAGASLVQLYTGLVYRGPSIAREINEGLLDLLAEDGFDSA
                    :   :. . :  *   * ::  . .      .::  *       : *   **  :   * 

4256|hp|hhi         CDSFTEA-
1052|gene|hwa       ESAIGADI
2507|gene|nrc1      EDAVGADL
3140|gene|hbo       DEAVGADL
19|gene|hla         EAAVGADL
428|gene|nph        EDAVGVDI
1678|gene|hut       EDAVGADL
12969|gene|hma      EDAVGADL
229|gene|hhi        EDAVGVDL
                      :.