HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0543COG1632KOG1678arCOG04209Ribosomal protein L15E50S ribosomal protein L15E

HOG Organism Gene ID Name Annotation
cHOG0543 nrc1 VNG0177 rpl15e 50S ribosomal protein L15E
cHOG0543 hmu HMUK0277 Hmuk_0277 Ribosomal protein L15e
cHOG0543 hma RRNAC2065 rpl15E 50S ribosomal protein L15e
cHOG0543 hwa HQ1424A rpl15R 50S ribosomal protein L15e
cHOG0543 hla HLAC0413 Hlac_413 Ribosomal protein L15e
cHOG0543 hbo HBOR26510 Hbor_26510 LSU ribosomal protein L15E
cHOG0543 hut HUTA2385 Huta_2385 Ribosomal protein L15e
cHOG0543 hvo HVO_0561 HVO_0561 Ribosomal L15
cHOG0543 nph NP0246A rpl15R 50S ribosomal protein L15e
cHOG0543 hhi 2558 rpl15E 50S ribosomal protein L15e
MUSCLE (3.6) multiple sequence alignment


12065|gene|hma      MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQG
2558|gene|hhi       MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRDEGAVERIERPTRLDKARSQGYKAKQG
177|gene|nrc1       MARSFYSHIKEAWEDPDDGKLAELQWQRKQDWRKEGAIERVDRPTRLDKARELGYKAKQG
413|gene|hla        MARSFYSHIKEAWRSPKEGKLAELQWQRKQEWRDEGAIERIERPTRLDKARELGYKAKQG
1424|gene|hwa       MARSFYSHIKEAWKQPGDGKLAELQWQRKQEWRDQGAIVRIDRPTRLDKARELGYKAKQG
26510|gene|hbo      MARSFYSHIKDAWKNPGDGKLGELQWQRKQDWRDEGAIVRIDRPTRLDKARELGYKAKQG
2385|gene|hut       MARSFYSHIRDAWKNPDEGKVAELQWQRMQRWREQGAIERVERPTRLDRARSLGYKAKQG
246|gene|nph        MARSFYSHIREAWKTPKEGKLAELQWQRQQEWRDQGAIERIERPTRLDKARSLGYKAKQG
                    **** **:*.:**  * :*::.****** * **.:**: *::******.**. *******

12065|gene|hma      VIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYS
2558|gene|hhi       VVVARVSVRKGGARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYS
177|gene|nrc1       VVVVRVSVRKGTARKSRFKAGRRTKRQGVNRIGRAKNLQRIAEERASRKYVNLRTLNSYW
413|gene|hla        VVVARVSVRKGGSRKQRHKAGRRSKRQGVNRLSRRKSIQRISEERASRKYRNLRVLNSYW
1424|gene|hwa       VIIARVAVRKGGARKKRFTSGRRSKRQGVNRLGRRTSIQRIAEERAARKYPNLRTLASYW
26510|gene|hbo      IVVARVSVRKGGARKQRFKAGRRTKRQGVNRIGRRKSIQRIAEERAARKYPNLRVLNSYW
2385|gene|hut       IVVARVSVRKGSARKERHIAGRRSKRQGVTRITRRKNLQRVAEERASRKYRNLRVLNSYW
246|gene|nph        VVVARVSVRKGTARKQRFKAGRRSKRQGVNKITRRKNLQRIAEERSGRKFRNLRVLNSYW
                    :::.**:**** :** *. :***:*****..: * ..:**::***:.*.: ***.* ** 

12065|gene|hma      VGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKG
2558|gene|hhi       VGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKG
177|gene|nrc1       VGEDGSQKWFEAILLDPEHGAIQNDDDLNWICDDSHKNRVFRGKTSAGRRARGLQNRGKG
413|gene|hla        VGEDGSQKWHEVILVDPNHPAIENDGDLGWIASDDHKGRAFRGLTSAGTKGRGQRTRGTG
1424|gene|hwa       VGEDGSQKWHEIILIDPEHAAIENDDDLNWICDDTHKGRAFRGLTNAGRSNRGLQNRGKG
26510|gene|hbo      VGEDGSQKWHEIIMVDPEHPAIESDDDLNWICSDDHKGRTFRGLTNAGKSNRGLTTRGKG
2385|gene|hut       VGEDGSQKWFETILVDPNHPAIENDDDLNWICDDEHESRAMRGLTSAGQRNRGLNGRGKG
246|gene|nph        VGEDGSQKWFEVILLDPEHGAIQNDDDLSWICDDSQRGRAYRGRTSAGQRGRGQQKRGKG
                    **:** ***.* *::**:* **:.*.**.**. * : .*. ** *.**   **   .*.*

12065|gene|hma      SEKTRPSLRSNGGKGK
2558|gene|hhi       SEKTRPSLRSNRGKGK
177|gene|nrc1       TEGLRPSTNADKRNKS
413|gene|hla        TEKTRPSVTGNDRQGK
1424|gene|hwa       AEHTRPSAGSGSRRGK
26510|gene|hbo      SEHTRPSIRGDRRRGK
2385|gene|hut       TEHTRPSNSGDSGRAK
246|gene|nph        TEHTRPSIRANDKRGK
                    :*  ***  ..  . .