HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0541COG0177KOG1921arCOG00459Predicted EndoIII-related endonucleaseendonuclease III

HOG Organism Gene ID Name Annotation
cHOG0541 nrc1 VNG0592 nthA2 endonuclease III
cHOG0541 hmu HMUK3103 Hmuk_3103 endonuclease III( EC:4.2.99.18 )
cHOG0541 hma RRNAC0739 nthA endonuclease III
cHOG0541 hwa HQ1545A nthA endonuclease III; DNA-(apurinic or apyrimidinic site) lyase
cHOG0541 hla HLAC0954 Hlac_954 endonuclease III
cHOG0541 hbo HBOR23710 Hbor_23710 DNA-(apurinic or apyrimidinic site) lyase /endonuclease III (EC 3.2.2.-)( EC:4.2.99.18 )
cHOG0541 hut HUTA0584 Huta_0584 endonuclease III
cHOG0541 hvo HVO_0848 HVO_0848 nth endonuclease III
cHOG0541 nph NP4496A repair DNA N-glycosylase / DNA-(apurinic or apyrimidinic site) lyase
cHOG0541 hhi 1386 nth1 endonuclease III
MUSCLE (3.6) multiple sequence alignment


592|gene|nrc1       MGTRLETRSAQVGTVIDRLREQHPDPEISLRFSSRMELLVAVILSAQCTDERVNAETEHL
1545|gene|hwa       MGKPRTDRTQQVDTVLRRLAERYPDSTISLQFSNRLELLIAVVLSAQCTDERVNSITADL
4496|gene|nph       MGTPLEPRESQVAEVLDRLYEEYPEPEISLRFSNRLELLVAVVLSAQCTDERVNTVTETL
954|gene|hla        MGTPLEPREEQVEEVLDRLYEEYPDSTISLNYSNRLELLIAVILSAQCTDERVNKVCADL
10739|gene|hma      MGTPLESREEQATEVVDRLHEEYPDSTISLNYSSRLELLIAVVLSAQCTDERVNEVTADL
1386|gene|hhi       MGTLLESREEQATEVVDRLHEEYPDSAISLNYSNRLELLIAVVLSAQCTDERVNEVTADL
584|gene|hut        MGTSLDSRSAQATEVIERLHDAYPDTTISLTFSNRLELLVAVVLSAQCTDERVNETTPEL
23710|gene|hbo      MGTSLDTREAQVEEILDRLYEAYPDTTISLNFSTRLELLIAVVLSAQCTDERVNEVTAEL
                    **.    *  *.  :: ** : :*:. *** :*.*:***:**:***********     *

592|gene|nrc1       FDTYETVADYANADEEALAAELNSITYYNSKAGYIKSAAQSILEDHDGAVPDTMSDLTDL
1545|gene|hwa       FEKYETATDYAAADTDELAEDIYGITFHNNKAGYLKSIGETLAADYDGDVPDTMDELTAL
4496|gene|nph       FEKYETPEEYASADKEELASDIDSITYYNNKAGYLTSACADIVEKHNGEVPDTMSELTDL
954|gene|hla        FETYETPEDYANAPQEELAEAINSITYYNNKAKYIRSACADIAEQHDGEVPDTMSELTEL
10739|gene|hma      FEKYQGAEDYAAASEEQLAEDIYGITFHNNKGGYLQGIGEILTEEHDGEVPDTMSALTDL
1386|gene|hhi       FEKYQSAEDYAEATEEQLAEDIYGITFHNNKGGYLQGIGEILAEEHDGEVPDTMSALTDL
584|gene|hut        FETYQTPEDYAAADEEQLAEDIYGITFHNNKAGYLKGIGEILVEEHDGEVPDTMDALTAL
23710|gene|hbo      FEKYQTPEDYAAADVEELADDIYGITFHNNKAGYLQSIGETLVEEHDGEVPDTMSELTDL
                    *:.*:   :** *  : **  : .**::*.*. *: .    :  .::* *****. ** *

592|gene|nrc1       SGVGRKTANVVLQHGHDLTQGIVVDTHVQRLSRRLGITEKKRPEAIETDLMPVVPEDHWK
1545|gene|hwa       SGVGRKTANVVLQHGHDVVEGIVVDTHVQRITRRLGLTDEQTPKQIETDLMESVPESEWQ
4496|gene|nph       AGVGRKTANVVLQHGHEVVEGIVVDTHVQRISRRLGMTTEKRPDAIEDDLIDIVPQDDWK
954|gene|hla        AGVGRKTANVVLQHGHDVVEGIVVDTHVQRITRRLAITEEESPKKIEQDLLDVVPEEDWQ
10739|gene|hma      PGVGRKTANVVLQHGHDIVEGIVVDTHVQRLSRRLELTEEERPEAIEQDLLDVVPESEWQ
1386|gene|hhi       PGVGRKTANVVLQHGHDIVEGIVVDTHVQRLSRRLGLTEEERPEAIEQDLLDVVPSDEWQ
584|gene|hut        PGVGRKTANVVLQHGHDVVEGIVVDTHVQRLTRRLGLTEEERPDAIEDDLMEIIPEDEWQ
23710|gene|hbo      SGVGRKTANVVLQHGHDVVEGIVVDTHVRRLSRRLGITEEERPEKIEQDLMPVVPEADWQ
                    .***************::.:********.*::*** :* :: *. ** **:  :*.  *:

592|gene|nrc1       NYTHWLIAHGRETCTARNPDCGACVLADICPSSKTDHDIDLADGSEW--
1545|gene|hwa       QFTHLFISHGRETCTAQNPDCTDCILESVCPSSKCDHDIDLASNTPWK-
4496|gene|nph       EFTHLLISHGRETCTARNPDCGDCILEDICPSSKLDNDIDLADGNGWSD
954|gene|hla        QFTHLMIDHGRATCTAINPDCGDCVLADVCPSEKADGDVDLASGEAW--
10739|gene|hma      QFTHLLIDHGRAVCGARSADCEACVLADICPSEKGDSEVDLASGEAW--
1386|gene|hhi       QFTHLLIDHGRAVCGARSAECGACVLADICPSEKGDSDVDLASGEAW--
584|gene|hut        AFTHLMISHGRAVCTARNPDCGDCALEDVCPSSKLDSDVDLASGEAWE-
23710|gene|hbo      QFTHLFISHGRAVCDARNPDCDECVLEDLCPSSKLDHDVDLASGEAW--
                     :** :* *** .* * ..:*  * * .:***.* * ::***..  *