HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0540COG1865arCOG01870Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0540 nrc1 VNG1583 vng1583 no entry
cHOG0540 hmu HMUK0140 Hmuk_0140 protein of unknown function DUF105( EC:3.5.1.90 )
cHOG0540 hma RRNAC1935 hypothetical protein
cHOG0540 hwa HQ1406A cbiZ adenosylcobinamide amidohydrolase
cHOG0540 hla HLAC0236 Hlac_236 protein of unknown function DUF105
cHOG0540 hbo HBOR26120 Hbor_26120 uncharacterized conserved protein( EC:3.5.1.90 )
cHOG0540 hut HUTA2500 Huta_2500 Adenosylcobinamide hydrolase
cHOG0540 hvo HVO_0592 HVO_0592 Adenosylcobinamide amidohydrolase
cHOG0540 nph NP5300A cobalamine operon protein
cHOG0540 hhi 2444 HAH_2444 cobalamine operon protein
MUSCLE (3.6) multiple sequence alignment


5300|gene|nph      ------------------------------MFDFERTSDRLTVREPGTRWLSNGFDGGYT
1406|gene|hwa      MTEENTESDTTSDVTDCTDHNISSENDDMTFFDLTVRDGVCRLYRPDTRWLSTGYNGGVS
11935|hp|hma       ---------------------------MRWMFETTVRDSVCQIRREGARWLSTAWDGGYR
2444|gene|hhi      ------------------------------MFETTVEDGVCQVRREGANWLSTAWDGGYR
2500|gene|hut      ---------------------------MSRHFETTRRGGVLRLERSDTRWLSTGWNGGFC
1583|chp|nrc1      ------------------------------MFETTLHDGVLELAAPGARWLSTGWNGGDT
26120|hp|hbo       --------------------------MLTPVFDATVRDDVLQLSRPETRWLSTGHAGGES
236|gene|hla       ------------------------------MFEAAVRDGVLRLRRPETRWLSTGWNGGRL
                                                  *:    ..   :    :.***..  **  

5300|gene|nph      VADAAHNLTVPDGFGRTDLDAYAAERLGEPPA----------------------------
1406|gene|hwa      RGDVAYLLSVPHGWTETAVSAYVAERCATAGFEYISTFTDGRGRSLTDTQTETPHNTTHA
11935|hp|hma       TADAVYNVTVPEGFERTDLDAYRAERLSGAGF----------------------------
2444|gene|hhi      TADAVYNVTVPEGFERTDLDAYRAERLSATGF----------------------------
2500|gene|hut      RAGAAYNCTVPAGWNPDDIRADVTQRLDDAGF----------------------------
1583|chp|nrc1      RADRAYSITVPDDWAPDSTHEYVTDRLAAAGF----------------------------
26120|hp|hbo       RGPVAYNVSVPEGWDEMDVDGYVERRLDAAGF----------------------------
236|gene|hla       RADAAYNVSVPEGFDRTDLGAYRDERLARAGF----------------------------
                    .  .:  :** .:           *   .                              

5300|gene|nph      ---------------GPTLLTGVNQQHARGGRLGPVVAVVTAGLSNPATLPM--------
1406|gene|hwa      GTDDTIWMNAETRTYAPALLTGVDLQHARRARLDPVEVIVTAGVSNPATLPMSETINDNQ
11935|hp|hma       -------------AVGPTLLTGVHMEHARCARSGSVSVLATAGLSNPAALPMS-------
2444|gene|hhi      -------------PLGPALLTGVHMEHARCVRSGPVSVLATAGLSNPAALPMS-------
2500|gene|hut      -----------DRGDGPVLLTGVDQRHARGARLGPVTVFGTVGLSNPATLPVD-------
1583|chp|nrc1      ----------APRDDAPVLLTGVAQEHARIARCGPVAVAATAGLSNPAALPM--------
26120|hp|hbo       ------------DEKGPTLLTGVSMRHARRARLGPVEVVATAGVSNPAALPV--------
236|gene|hla       ----------KSEEDPPTLFTGVSMVHAYGARLGSVVAYATVGLSNPAMLPMD-------
                                   *.*:***   **   * ..* .  *.*:**** **:        

5300|gene|nph      -----------------AASADDGRTDGADR-EWRPGTVNIVVGTRRPLSDGGLAGLLAT
1406|gene|hwa      STENAMTDTEPDTKIDTSGELDDSQINKSDRDD--FGTVNIILGTTRSLTPGALSNLVAV
11935|hp|hma       -------AAET------ADGSDGTASNPADSPDWRPGTVNLIVGVDRALDEGALATLLAT
2444|gene|hhi      -------GEGT------ADDSDGTASNPADSPDWRPGTVNLVVGVDRALDSGALATLLAT
2500|gene|hut      -------PAQK------PADTRAATGAETGGPP-GPGTVNLFVGTTRSLTEAGMANLVAI
1583|chp|nrc1      -------------------DPDGGTLPDAKRAP--PGTVNLVAATTRALDDAALSNLVAV
26120|hp|hbo       -----------------ADSAHSTAHSRTDDPP--AGTVNVFVGTTRDLAAGALANLVAV
236|gene|hla       -------PTGVTGATDDAGDSEPGAAASTGEPPRRPGTVNLVVGTTRRLADGAAANLVAV
                                               :       ****:. .. * *  .. : *:* 

5300|gene|nph      AVEAKTATLSAVAGCTGTTSDAVAVGCPSGDTPEPFAGSATEVGAAVRACVREALLASLA
1406|gene|hwa      VSEAKAATLMTQTGFTGTTSDAVLIASDPTGNMKRFSGSATAVGNAARVCVRDALCAALA
11935|hp|hma       AVEAKAATLLDAASVPGTTSDAAIVGCVPSAERASFAGSATEIGAATRVCVRDAIRASLA
2444|gene|hhi      AVEAKAATLLDAAGVPGTTSDAAIIGCVPSAESAPFAGSATEIGAAARVCVRDAIRSSLA
2500|gene|hut      VAEARTATLLELAGFTGTTSDAIVVACDPGGEPARYTGSATPVGSAARACVREALTASYR
1583|chp|nrc1      AAEAKAATLLATAGFPGTTSDAVVVACDPGGETAPYSGSATPVGAATRACVREAVRASLD
26120|hp|hbo       AAEAKTATLLAQTGFPGTTTDAIIAACDPAGETTLYSGSATEVGAATRACVRDALCASLE
236|gene|hla       AAEAKAATLLATAGVPGTTSDAVVVGDDPTGEPAAFSGSATPVGAAARVCVRDAVRASLR
                   . **.:***   :. .***:**   .  .      ::**** :* *.*.***:*: ::  

5300|gene|nph      SRY---EDG--PPAPADAEHGVETDDRAAVFQP------------
1406|gene|hwa      SRY---KSEPLPTSVEMASHGIVTDDRAFVSPVQISEETDTTTES
11935|hp|hma       ARY---GGDALP-TVDGAEYGVVTDQDTEIFKP------------
2444|gene|hhi      ARY---DGDSLP-TVDDAAYGVVTDRETEVFEP------------
2500|gene|hut      SRY---SGWKPPESVADAEHGESTTCRATVFEP------------
1583|chp|nrc1      SRD---AAS--PDSVESAAHGTTTDVQAAVFRP------------
26120|hp|hbo       SRYSAADGNELPDSVEDAKYGVVTDERAAVSQILTDENDGEAL--
236|gene|hla       SRY---PDGDLPGPAADAEHGVVADERAEVFEL------------
                   :*         * .   * :*  :   : :