HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0054COG1422arCOG02673Predicted membrane proteinHtr-like protein

HOG Organism Gene ID Name Annotation
cHOG0054 nrc1 VNG0834 vng834 no entry
cHOG0054 nrc1 VNG1726 htlB Htr-like protein
cHOG0054 hmu HMUK1735 Hmuk_1735 protein of unknown function DUF106 transmembrane
cHOG0054 hmu HMUK1152 Hmuk_1152 protein of unknown function DUF106 transmembrane
cHOG0054 hma RRNAC3344 htlB HTR-like protein
cHOG0054 hwa HQ2766A hypothetical protein
cHOG0054 hla HLAC1913 Hlac_1913 protein of unknown function DUF106 transmembrane
cHOG0054 hbo HBOR09210 Hbor_09210 predicted membrane protein, COG1422
cHOG0054 hut HUTA2320 Huta_2320 protein of unknown function DUF106 transmembrane
cHOG0054 hvo HVO_2495 HVO_2495 htlB HTR-like protein
cHOG0054 nph NP4912A adk/cmk cluster protein
cHOG0054 hhi 1924 HAH_1924 hypothetical protein
cHOG0054 hhi 585 htlB HTR-like protein
MUSCLE (3.6) multiple sequence alignment


1924|hp|hhi         ------------------------------------------------------------
834|chp|nrc1        --MPDTQLASLLQT-AAMREAASAVLEESDARTGDIQWDDVSDAVSSSQWGRLISAGVLT
1726|gene|nrc1      MARTAEKVQSLVREDPEMATILEDLLDHD----GDLQWQDVSDDVSSGQWGRLLEKDILV
1913|gene|hla       MSKVERRVRSLVREDGEMRDAVEVILDSATD--GEVQWIDVRDEITSGQWGRLIEKEILV
2766|hp|hwa         MPRIESKVRDLVAGDDGMRAAVEIVLDRADD--GDVKWLDVKDELSSGRWGRLIETGVLI
9210|hp|hbo         MVRIEQKVRDLVSSDPEMRNAVETVLERAND--GEVKWVDVKGDITSGHWGRLIEKGVLV
4912|gene|nph       MARTASKVQSLVKEDAEMEEALEYVLETADE--GSVSWGDVSDELTSGQWGRLIEKGILV
2320|hp|hut         MPRTGEKIDRLVAEDASMETAIQTVLQTAEEQ-GTVAWGDVSDELSSGQWGRLIETGLLV
13344|gene|hma      MARTAPKVERLAEDGEAMTDALSTVLAAAEEN-GTVTWGDVSDDLTSGEWGRLIESGLLI
585|gene|hhi        MARTAPKVERLAEDGEAMTDALSTVLAAAEEN-GTVTWSDVSDDLTSGEWGRLIESGLLI
                                                                                

1924|hp|hhi         ------------------------------------------------------------
834|chp|nrc1        STD-TGFVVADPDELAAELAAHTDAESTEHTD-----APAIESASWTIYDKAAAVGAIGL
1726|gene|nrc1      EGD-TGFEVGDPDGVEEGLAPDDDGD-----------DDSPEGTSWSTYDKLAGVGAVGA
1913|gene|hla       DGD-TGFALADRDAIAAGLEDDDDGDLTSSD------VDTPETTTWSKWDKIAGIATLGA
2766|hp|hwa         EGE-EGFQLADRAATESGLETDDSSDTSTDSNVALETEVDDDESSWSIYDKGAGVLTIGL
9210|hp|hbo         DGD-EGFELADPEAARAGLENGSSGSSVSTSSSVD--TDDLGESSWSKYDKMAGVVTVGL
4912|gene|nph       DSDGEGFDVDDPDGVREALEDDDLEFP----------DPPDADSSWTKWDKGAAVGSVAM
2320|hp|hut         DADGDGFVIDDPDGVHDALEEADP-------------DAEDDDDGWSTWDKLAGVGVIAL
13344|gene|hma      DADGEGFVIDDPDGVREALEESDAAP-----------SDDDEGSGWSKWDKLAGLGTLGL
585|gene|hhi        DADGEGFVIDDPEGVREALEESDAEP-----------SDDDDDSGWSKWDKLAGLGTLGL
                                                                                

1924|hp|hhi         --------------------------MASALNAVYLALVVVVGVVGTLFVASI-------
834|chp|nrc1        FAGYWNSSIQTTI-ASVDNQLLAPVMNLLPFHIVVLVLAVTTGVYSTYLQSRLMDHETLQ
1726|gene|nrc1      MIGYSYSPIKNAI-GGTINVVLGPLDSIMPFYVVILVLAVLTGLYTTILQANLTDMEKMS
1913|gene|hla       FVGYAVNPVRNAI-AGAFDLVLGPLLNVVPFYVVVMVIALATGLYSTLLRAGLMDMDKMS
2766|hp|hwa         FVGYSWKPLRDLI-GTVMDVPLGPLEELLPFYAVVMILALATGLYSTLLQANLMNMEKMS
9210|hp|hbo         FFAYWWQPLQRLI-GSTMNVILGPLVEILPFYAVVMIIALATGLYSTLLQANLMNMEKMS
4912|gene|nph       FAGYMFDSVREPL-ADALNLLLGPLLDLLPFFAVVMVLALFTGLYSTLLQSNLMDMEVMG
2320|hp|hut         FLGYSMTSVRNVV-GETLDLILGPLEALLPFYVVILVLATLTGLWSTLLQDNLMDMSGMS
13344|gene|hma      FAGYSLTSVRDVIAGGVIDIVLGPLNDMLPFYVVILVLAIITGTTSTILQDNLMDMSGMG
585|gene|hhi        FAGYSMTSVRDVIAGGVIDIVLGPLNDMLPFYVVILVLAIITGTTSTILQDNLMDMSGMG
                                                 .:  * : :.  .*   * :   :       

1924|hp|hhi         ----RSADVRSR------------------------------------------------
834|chp|nrc1        AYKDRMAALKERREAAKERGDDEALERIQSEQMDAAGDQLGLFKLQFRPMVWIMLLTIPV
1726|gene|nrc1      KYQEQAQELQDKMSAAKERGDDAAVERLREEQMEAFGDQASMMKEQFRPMVWIMLLTIPV
1913|gene|hla       AYQDRMKDIQDRRKDAKERDDQEALDAIQEEQMEAMGDQLGMFKEQFRPMVWIMFLTIPA
2766|hp|hwa         AYQSRMKEIQERRKEAKEEGDDDALDAIQDEQMDAMGDQLGMFKEQFRPMVWIMFLTIPV
9210|hp|hbo         AYQERMKDIQKRRKEAQKAGDDEALDRIQQEQMEAMGDQMGMFKEQFRPMVWIMFLTIPA
4912|gene|nph       KYQGRMKEIQERRKEAKERGDDEALERIQEEQMEAMADNLGMFKEQFRPMVWIMLLTIPV
2320|hp|hut         QHQEKMEELKERRKAAKERDDQEELDRIQQEQMEMMGDQLGAFTKQFRPMVWIMLLTIPV
13344|gene|hma      DHQEKMEDLKERRKAAKERDDQEALDRLEEEQMELMTDQMGMFKQQFRPMVWIMLVNIPL
585|gene|hhi        DHQEKMEDLKERRKAAKERDDQEALDRLEEEQMELMTDQMGMFKQQFRPMVWIMLVNIPL
                        .   :...                                                

1924|hp|hhi         ----------------------------------------------------WLELSSIG
834|chp|nrc1        FLWLRWEVRGGHLGASE--------HGMVVPLAGHVA-WQHALLGPMATWIVWYFVCSMA
1726|gene|nrc1      FLWMYWKL---GTGTIP-----QSELNMVLPLLGEID-LNGGRVLVFPAWILWYMMCSFS
1913|gene|hla       FLWMFWVI---GYRGSTAAYPDVAAQELIVPLAGTVT-WDTGIVGPIQMWIVWYFLCSMA
2766|hp|hwa         FLWMYWSI---GVGANAEA--QVSLSTLVLPLVGEVA-WTDSVLGPIQAWIVWYFLCSMG
9210|hp|hbo         FIWMYWAI---GVRGSG-G--HIVLQNIVLPLVGKVS-WTEGVLGPMQAWIVWYFLCSMG
4912|gene|nph       FLWMYAVV---GFRGAP-LYPEIELVPVVMPIAGEVD-WTHGLLGPIQVWIVWYFVCSMC
2320|hp|hut         FLWMYWRVPNLASGEFV----------IIMPFFGEISRWGAGTLGPWPAWLFWYFICSLS
13344|gene|hma      FLWLYWIVFGAGVDASP---------VITLPIFGEVEAWSNSVAGPVQAWIVWYFLCSLS
585|gene|hhi        FLWLYWIVFGAGVDASP---------VITLPIFGEVEAWSNSVAGPVQAWIVWYFLCSLS
                                                                        *  :.*: 

1924|hp|hhi         IVVLFLLSLGVQFLA---
834|chp|nrc1        SRQFLQKTFNIQAST---
1726|gene|nrc1      FSNIIRKALNIQTTPT--
1913|gene|hla       FTQLVQKSLNIEMSPSSS
2766|hp|hwa         FTQIIRKSLNIDISPSAS
9210|hp|hbo         FTQIIRKSLDIDISPSTS
4912|gene|nph       FTQVLRKALNIQTTPT--
2320|hp|hut         FTQIIRKALNVQTTPT--
13344|gene|hma      FTQIIRKALNVETTPTG-
585|gene|hhi        FTQIIRKALNVETTPTG-
                       ..  ::.::  .