HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0539COG1890KOG1628arCOG04186Ribosomal protein S3AE30S ribosomal protein S3E

HOG Organism Gene ID Name Annotation
cHOG0539 nrc1 VNG0787 rps3e 30S ribosomal protein S3E
cHOG0539 hmu HMUK2131 Hmuk_2131 ribosomal protein S3Ae
cHOG0539 hma RRNAC1429 rps3AE 30S ribosomal protein S3Ae
cHOG0539 hwa HQ2358A rps3aR 30S ribosomal protein S3Ae
cHOG0539 hla HLAC0618 Hlac_618 ribosomal protein S3Ae
cHOG0539 hbo HBOR20960 Hbor_20960 SSU ribosomal protein S3AE
cHOG0539 hut HUTA0722 Huta_0722 ribosomal protein S3Ae
cHOG0539 hvo HVO_1145 HVO_1145 RPS1A 30S ribosomal protein S3Ae.
cHOG0539 nph NP3210A rps3aR 30S ribosomal protein S3Ae
cHOG0539 hhi 2013 rps3AE 30S ribosomal protein S3Ae
MUSCLE (3.6) multiple sequence alignment


787|gene|nrc1       MSERSVSKQDQEKRWYTVLAPEEFDRAELGETLAEEPDQVYDRTIQAALSDVR-DGGDNN
2358|gene|hwa       MSERSVSKQKSSDRWYSIIAPEQFDRSELGSTFADDPEKIHGRTLEVTLGDITGDQGENN
20960|gene|hbo      MSERSVSKQKRGKRWYTLIAPEQFDREELGETMADEPEKVDGRTIEVTLGDLTGDQGANN
618|gene|hla        MSERSVSKSREQKRWYSVLAPEQFDRQELGETLAEEPDQVVGRTITTTLGELTGDSGANN
3210|gene|nph       MSERSVSKQKQEKRWYTVMAPEIFDRAELGETPADEPEQVYDRTVQTTLGELQNDPSENN
722|gene|hut        MSERSVSRQTQEKRWYTVLAPEEFGREELGTTPADEPEQVLGRTIETTLGDLRNDAGENN
11429|gene|hma      MSERSVSKRTEQKRWYTVQAPEQFDREVLGKTPAEEPDKVLGRTIETTLGELTNDASENN
2013|gene|hhi       MSERSVSKRAEQKRWYTVQAPEQFDREVLGKTPADEPDKVLGRTIETTLGELTNDASENN
                    *******.    .***:: *** *.*  ** * *::*::: .**: .:*.::  * . **

787|gene|nrc1       IKLTFQIDDVGSDSASTQFVQAELTRDYQRSLVRRGSSKVAVTVTVLTTDDYRVRIQPVA
2358|gene|hwa       TKLTFKVNDVTSDAAYTEFIKHELARDYLRSLIRRGASKIDAAITVRTTDDYRVQLQPVA
20960|gene|hbo      TKLTFKVNDVSSDSAYTEFIKHELARDYLRSLVRRGASKISASITVLTKDDYRVQIQPVA
618|gene|hla        TKLTFKITDVGSDTAYTEFIKYELTRDYLRSLVRRGASKVEASITVLTTDDYRIRVQPVA
3210|gene|nph       TKLTFQISDVGSDTAYTDFVQHELTRDYLRSLTRRGTSKVDAFVTVLTTDDYRVQVQPVA
722|gene|hut        TKLTFRIRDMGSDTAYTEFIRHELTRDYLRSLVRRGSSKVEAYVTVLTTDDYRVQIQPVA
11429|gene|hma      TKLTFKINEVASDSAYTEFIRHELTRDYLRSLVRRGSSKVEAYITVLTTDDYRVQIQPVA
2013|gene|hhi       TKLTFKINEVASDTAYTEFIRHELTRDYLRSLVRRGSSKVEAYITVLTTDDYRVQIQPVA
                     ****.: :: **:* *:*:. **:*** *** ***:**: . :** *.****:.:****

787|gene|nrc1       YTTKQADQSQQHAIRRTMIDLVEEAGEERTFEALLNS-IIEGRLSSAIYDEANTIYPLRR
2358|gene|hwa       FTTKKADRSQEQAIRRVMIDLVEDAADERTFADLIDA-AIEGQLSSAIYGEAKTIYPLRR
20960|gene|hbo      FTTKKADRSQEQAIRRVMIDFVEEAAQERTFEELVDSAVVDGRLSSAIYGEAKTIYPLRR
618|gene|hla        LTTKKADRSQEKAIRRVMIDKVHAAAEDRTFESFVDA-IVEGNLSSAIYGDAKLIYPLRR
3210|gene|nph       YTTKSADRSQEQAIRSTMVDLVEESAADNTFADLIDS-IVEGRLSSAIYNEAKTIYPLRR
722|gene|hut        LTTKKADASQEQAIREQMVEMIEEAAEERTFDDLIDS-VVEGRLSSAIYNEAKTIYPLRR
11429|gene|hma      VTTKKADASQEKAIRRTMIDLVRETAEDHTFEQLIDS-VVEGRLSSAIYGEAKDIYPLRR
2013|gene|hhi       VTTKKADASQEKAIRRTMIDLVRETAKDRTFEQLIDS-VVEGRLSSAIYGEAKDIYPLRR
                     ***.** **::***  *:: :  :. :.**  ::::  ::*.******.:*: ******

787|gene|nrc1       VEVEKATLEAHPEEVHEEEETAVDFSGE--------
2358|gene|hwa       VEVKKLTLEARPEEVAAEEAAAVDVDEADVAVE---
20960|gene|hbo      VEVQKLTLEARPEEVAAEEEAAVDVDEEDIAVDEA-
618|gene|hla        VEIQKLTLEARPSEVAAEEETAVDVDADEVAVDADE
3210|gene|nph       VEIQKTRLQASPEEVAAEEEASVDVDD---------
722|gene|hut        VEIQKTTLEAHPEEVAEEEETSVDVEE---------
11429|gene|hma      VEIKKTTLEARPEEVAAEEETAVDVDEEDVDVEA--
2013|gene|hhi       VEIKKTTLEARPEEVAAEEETAVDVDEEDVDVEA--
                    **::*  *:* *.**  ** ::**..