HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0538COG1594KOG2907 KOG1105 KOG2691 KOG2906arCOG00579DNA-directed RNA polymerase subunit M/Transcription elongation factor TFIISTranscription elongation factor TFIIS

HOG Organism Gene ID Name Annotation
cHOG0538 nrc1 VNG0426 tfs2 Transcription elongation factor TFIIS
cHOG0538 hmu HMUK3187 Hmuk_3187 transcription termination factor Tfs( EC:2.7.7.6 )
cHOG0538 hma RRNAC0218 rpoM DNA-directed RNA-polymerase subunit M
cHOG0538 hwa HQ2396A rpoM1 DNA-directed RNA polymerase subunit M1
cHOG0538 hla HLAC0970 Hlac_970 Transcription factor TFIIS
cHOG0538 hbo HBOR18510 Hbor_18510 DNA-directed RNA polymerase, subunit M( EC:2.7.7.6 )
cHOG0538 hut HUTA0231 Huta_0231 transcription termination factor Tfs
cHOG0538 hvo HVO_1385 HVO_1385 rpoM DNA-directed RNA-polymerase subunit M
cHOG0538 nph NP0364A rpoM_1 DNA-directed RNA polymerase subunit M 1
cHOG0538 hhi 965 rpoM1 DNA-directed RNA polymerase subunit M
MUSCLE (3.6) multiple sequence alignment


231|gene|hut        MEFCDECGSMMKT--EGDMWVCGS--CGAETPREAATESGM-VTTQGQE-AGEVVDLSDS
10218|gene|hma      MEFCDECGSMMKT--DDERWVCGS--CGYEKARNAEAEQEMAVTTQGQE-ESEVVDTSEV
965|gene|hhi        ---------MMKT--DDERWVCGS--CGYEKARNAETEQEMAVTTQGQE-ESEVVDTSEV
18510|gene|hbo      MEFCDECGSMMKT--DGGVWVCGS--CGFEKARDAAQESHM-TSTASRE-DSEIVDMSDV
364|gene|nph        MEFCDECGSMMHS--EDGLWVCRS--CGFEKQQGDDDADRM-TTTEGQDTDSGPVDMSEV
2396|gene|hwa       MKFCDECGSMMKK--QDDIWTCSD--CGAEELADEADSATM-TSTESQQ-ESGAVDVSDI
426|gene|nrc1       MEFCDDCGSMMKA--DDELWVCSS--CGHKQPKDPSASF---VVTEGQE-ETEVVDVSDA
970|gene|hla        MKFCDECGSMMKSGEGEDHWVCSSEDCGNELGRDNGDDE---WTTESQV-ESEVIDVSDA
                             **:       *.* .  ** :              * ..      :* *: 

231|gene|hut        EADAR-PTTEIQCVECDNDRAYWELKQIRAADESETRFFTCTECGHKWREDDH
10218|gene|hma      DAEDMGPTTGARCPECGNERAFYEMKQIRAADESETRFFTCTECEHKWREDDH
965|gene|hhi        DAEDMGPTTGARCPECGNERAFYEMKQIRAADESETRFFTCTECEHKWREDDH
18510|gene|hbo      DDAEIGPTTTVKCPECGHDRARYEMKQIRSADESETRFFTCVECSHKWREDDH
364|gene|nph        DDSEIGPTTRVNCPECGNDRARYEMKQIRAADESETRFFTCTECEHKWREDDH
2396|gene|hwa       DDADIGPTTTVICPECGNDTARYEMKQIRAADESETRFFTCTECNHKWREDDH
426|gene|nrc1       QDRGL-PTTSVVCPDCDNDEAHWYMQQIRSADESETRFFICTECEHRWREDDN
970|gene|hla        EDKGL-PKTTAHCPECGNDRAYWYMQQIRSADESETRFFVCTECEHKWREDDH
                    :     *.*   * :*.:: * : ::***:********* *.** *.*****: