HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0537COG0702KOG4288 KOG1203 KOG4039arCOG03015Predicted nucleoside-diphosphate-sugar epimerasesNADH dehydrogenase/oxidoreductase-like protein

HOG Organism Gene ID Name Annotation
cHOG0537 nrc1 VNG1932 nolA NADH dehydrogenase/oxidoreductase-like protein
cHOG0537 hmu HMUK1410 Hmuk_1410 NAD-dependent epimerase/dehydratase( EC:1.6.99.3 )
cHOG0537 hma RRNAC3285 nolA NADH dehydrogenase/oxidoreductase-like protein
cHOG0537 hwa HQ3146A nolA NADH dehydrogenase 32K chain
cHOG0537 hla HLAC1891 Hlac_1891 NAD-dependent epimerase/dehydratase
cHOG0537 hbo HBOR06430 Hbor_06430 predicted nucleoside-diphosphate sugar epimerase( EC:1.6.99.3 )
cHOG0537 hut HUTA1299 Huta_1299 NAD-dependent epimerase/dehydratase
cHOG0537 hvo HVO_2205 HVO_2205 nolA nadh dehydrogenase/oxidoreductase-like protein
cHOG0537 nph NP2406A nolA_1 NADH dehydrogenase 32K chain-like protein
cHOG0537 hhi 524 nolA NADH dehydrogenase/oxidoreductase-like protein
MUSCLE (3.6) multiple sequence alignment


1932|gene|nrc1      MAACVCDSMDVLVTGGTGFIGTHLCRELDDRGHDVTAFAREPADAALPADVTRIVGDVTV
3146|gene|hwa       --------MDVLVIGGSGFIGTRLCAELSNRDHNVTAVSRSPDNSELPADVDTKMGDVTA
6430|hp|hbo         --------MKVLVVGGSGFVGTNLCRELKERGHEVTALSRSPSSDELPKGVNKTMGNVTV
1891|gene|hla       --------MKVLVAGGTGFIGSYLCRALADGGHEVTALSRSPSDT--PEGVASATGDVTD
13285|gene|hma      --------MDVLVVGGTGFIGQHLCRALDEQGHAVTALSRSPEDATLPDGVETVAGDVTD
524|gene|hhi        --------MNVLVVGGTGFIGQHLCRELDDQGHTVTALSRSPEDATLPSGVETVAGDVTE
1299|gene|hut       --------MNVLVTGGDGFVGRHLCAELDERGHDVTALSRDPDPTVLPDGVETVAGDVTD
2406|gene|nph       --------MELLVVGGTGFIGTHLCAELHDRGHEVTAMSRSPDDGGVPEGVEATAGDVTT
                            *.:** ** **:*  **  * : .* ***.:*.*     * .*    *:** 

1932|gene|nrc1      KETVANAIDGHDAVVNLVALSPLFKPSGGDSRHLDVHLGGTENVVAAASEAGVEYILQLS
3146|gene|hwa       YDSLSGSFADIDAVYNLVALSPLFKPSGGDKMHDVIHRRGTENVVRAAEANGVSHLIQIS
6430|hp|hbo         YDSIKDAFEGMDAVYNLVALSPLFKPSGGNEMHDKVHRHGTENVVRAAEKHEVDRFVQMS
1891|gene|hla       YDSIASAVEGQDAVVNLVALSPLFEPKGGNVMHDRIHRKGTENLVRAAEEGGAERFLQLS
13285|gene|hma      YGSIESAFEGQDAVYYLVALSPLFKPDGGDKMHERIHLGGTENSVQAAEEHGVNRFVQLS
524|gene|hhi        YDSIESAFEGQDAVYFLVALSPLFKPDGGDEMHERIHLGGTENSVQAAEEHDVDRFVQLS
1299|gene|hut       RSSIEPAVEGVDVLVNLVALSPLFIPSGGNEMHERIHLGGTENLVAAAEDEGVERFVQMS
2406|gene|nph       YDSIEPAFEGVDAVVNLVALSPLFRPSGGDEMHYRIHRDGTENVVAAAEKHGVDRLVQLS
                      ::  :. . *.:  ******** *.**:  *  :*  **** * **.   .. ::*:*

1932|gene|nrc1      ALDADPTGPTAYLRAKGRAEEAVRSS--DLHHTIVRPSVVFGDGGEFVPFTKQL----TT
3146|gene|hwa       ALGADPDGSTAYIQAKGRAETAVTESDTDLEFTIFRPSVVFGDGGEFVSFTKLL----AP
6430|hp|hbo         ALGADPDGPTAYIRAKGEAEQIVTES--VLDWTIFRPSVIFGDGGEFVSFTKLL----AP
1891|gene|hla       ALGADPDGDTAYIRAKGQAEEIVRES--GLGWTIFRPSVVFGEGGEFVSFTKRLKGMFAP
13285|gene|hma      ALGADPNGDTHYIRSKGQAEQVVTGS--SLDWTIFRPSVVFGKGGEFVSFTKRLKGMFAP
524|gene|hhi        ALGADPNGDTHYIRSKGRAEQVVTES--SLDWTIFRPSVVFGEGGEFVSFTKRLKGMFAP
1299|gene|hut       ALGADPEGPTHYIRAKGRAEEVVRES--ALKWVIVRPSVIFGDGGEFVGFTKKL----TP
2406|gene|nph       ALGADPDGETAYIRAKGQGEDIVRSS--SLEWVILRPSVVFGDGGEFIPYTKQL----AP
                    **.*** * * *:.:** .*  *  *   *  .*.****:**.****: :** *    :.

1932|gene|nrc1      PY-VTGLPGGGA-SKFQPIWVGDLVPMLADALGTEAHWGETYDIGGPDVLTLADVTRMAY
3146|gene|hwa       PY-VSALPGGGK-TRFQPIWVNDLVPMLADAIDADTHHGEIYEIGGPERLTLAEIAKTIH
6430|hp|hbo         PY-VSALPGGGK-TRFQPLYVDDVVGMMADAIEDDAHIGERYEIGGPDKLTLAEIAKMIH
1891|gene|hla       GLPLYPLPGGGK-TRFQPIHVEDLVSMLVAALEEDEHVGETYEIGGPETLTLRQVTDLVY
13285|gene|hma      GVPLYPLPGGGSQTKFQPIWVGDLVPMLVDSIESEEHVGEAYEIGGPEVLTLRDVTNQVY
524|gene|hhi        GVPLYPLPGGGKQTKFQPIWVGDLVPMLVNSIESEEHVVETYEIGGPEVLTLRDVTNQVY
1299|gene|hut       PL-VAPLPGGGK-TRFQPIWVEDLAPMLADCVEDDERAGETYELGGPERLTLKQIAKLVR
2406|gene|nph       AY-LTPLPGGGK-TRFQPIWIGDLAPMIADAATEDEHAGEIYELGGPEALTLASIAKLAH
                       :  *****  :.***: : *:. *:. .   : .  * *::***: *** .::    

1932|gene|nrc1      RAAGKSVRVLPVPMPLAAVGLTLADPL--------PFVP-MGADQYRSLKLDNTTSANDV
3146|gene|hwa       TADGRSTTIVPIPMSLAKIGLTVGDVI--------PGFP-MGVDQYRSLQFDNVTDENDI
6430|hp|hbo         KSNGRSTTIVPIPMGLAKVGLTIGGAI--------PGVP-MGTDQYRSLKFDNVTDDNDI
1891|gene|hla       EAEKKGVTIIPLPMPLARIGLTVLGAV--------PGFP-MGADQYRSLKFDNTTAHNDV
13285|gene|hma      DAEGSSVSIVPLPMPLAKVGLSVLGSV---------GFP-MGADQYRSLKFDNSPATNDI
524|gene|hhi        DADGSSVSIVPLPMPLAKVGLSVLGSV---------GFP-MGADQYRSLKFDNTPTTNEI
1299|gene|hut       G----KVAVVPVPMALAGVGLSVAGAI--------PGFP-MGKDQYRSLRFDNTTADNDV
2406|gene|nph       AADGRPVNVLPIPMAVAGAGLKALGSVPESVLDSLPGVPRMGGDQYRSLQFDNTTDENDV
                          . ::*:** :*  **.  . :          .* ** ******.:** .  *::

1932|gene|nrc1      TAFDVDPSTLRTLAAYLGVE----------
3146|gene|hwa       DAFEKSLDDLTTLEAYLSGEDKQDDTRVPA
6430|hp|hbo         EAFGYGTGELTTLRAYLNNSHIRDK-----
1891|gene|hla       EAFGVDPAELTTLGEHLGVV----------
13285|gene|hma      DAFGVSSGSLTTLSGYLRG-----------
524|gene|hhi        DAFGVSSGSLTTLSGYLSG-----------
1299|gene|hut       TAFGTEPDVLFTLEDYLDGV----------
2406|gene|nph       AAFGVDSGTLRTVSDYLSIDD---------
                     **      * *:  :*