HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0535COG1944arCOG02882/2Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0535 nrc1 VNG1410 vng1410 no entry
cHOG0535 hmu HMUK2219 Hmuk_2219 protein of unknown function DUF181
cHOG0535 hma RRNAC1002 hypothetical protein
cHOG0535 hwa HQ2793A hypothetical protein
cHOG0535 hla HLAC2036 Hlac_2036 protein of unknown function DUF181
cHOG0535 hbo HBOR13720 Hbor_13720 uncharacterized conserved protein
cHOG0535 hut HUTA2949 Huta_2949 protein of unknown function DUF181
cHOG0535 hvo HVO_2860 HVO_2860 YcaO-like family domain protein
cHOG0535 nph NP2602A hypothetical protein
cHOG0535 hhi 1628 HAH_1628 hypothetical protein
cHOG0535 hhi 5267 HAH_5267 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10020|hp|hma       ------------------------------------------------------------
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        -MSYALAITGPGPSAAIDAAKQVMTSTNTGLDSDPCYPSSKSEPTFIHTESPADADVTVV
1628|hp|hhi        --MQTVEVVGRGP--AVDALTAFL---------------ADIDITVAQPSTPADSSGELA
2949|hp|hut        ---MTVGLVGAGP--AADAVESAL---------------SDVEGAVETAAPDEIDEYELA
2036|gene|hla      ---MDIGLVGDGP--AVEAVSAAL---------------GDVDVNVMPVEVGLLDGFDLA
13720|hp|hbo       MTTHDIALVGSGP--AAEAVRAAL---------------ADCDAAVNDTTPEDAAEAALA
1410|hp|nrc1       ------------------------------------------------------------
2602|hp|nph        --MTTVGIAGDAP--ATEAVRAAL---------------DDSAADTVAVDPAALGDVDIA
                                                                               

10020|hp|hma       ------------------------------------------------------------
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        VTTVEQTGEDGTTVIPGALSADSAMVFIEFGGMGGCPIDDIDAAITTLPAKGPTFETLQT
1628|hp|hhi        VVVDTVGSETFAAWNDRAKGDDVPWVAVELGGVGGVPV--TDAAISGFGPETGCFDCLRT
2949|hp|hut        IVIEVAGANAFEQANQRAIQTGTSWIAIELGGVGGVPV--VDAAITGFGPETACYECLRK
2036|gene|hla      VVVDTAGS----ETFAAANEHLDRWVAIEVGGLGGVPLEPVDAAVT--AFDETCYDCLRR
13720|hp|hbo       VVVAPAGA----TVPQTVGMAADRLVVVEIGGVGGVPLAELDAAVSVFA-GTSRYADLCT
1410|hp|nrc1       ------------------------------------------------------------
2602|hp|nph        VVSGDVGTGGFERAATTASETSTPLVCIEVGGIGGQAVAGVEAAVSGAAPGTACYECLRT
                                                                               

10020|hp|hma       ------------------------------------------------------------
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        RVMT-TTSPGDAGFAD--RTTIT-AGVLAGQRAVGMCTA--SAVDISGTVLEISGTKIGP
1628|hp|hhi        RVEA-TVDETEEITEAPAAATQRFTGALAGRLVTQFLDG--DTA-LFGTVTELP----HT
2949|hp|hut        RVRA-NVDPTEEPTKAPPPTTARFAGAVAGRAAASTLDRSVDGPEVVGFVREIP----DA
2036|gene|hla      RVASGGAEPADAPAGR--RSAVRYAGALAGRRVIQLLAG--DP--VADTVVEVP----GA
13720|hp|hbo       RVAA-TTDGGDSPSGG--RSAVRLAGAVAGRRAVALLTG--DDS-VVGTVAEISGTGVTA
1410|hp|nrc1       ------------------------------------------------------------
2602|hp|nph        RVAA-TAPDTDDGDTD--RATARFAGAVAGREVARLVAG--EESQLLGGVIEVP----HA
                                                                               

10020|hp|hma       ------------------------------------------------------------
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        ERDLIGTPDMYGHDGDMSERFIPEQTARDVNLDTSLSHAERAVDDRLGIITQVGERESFP
1628|hp|hhi        QRRFLPVPGC--DCSETPSRTLG-DGRRTAPDSEALSRAELGLDDRVGIATEVGEVESFP
2949|hp|hut        TRRLLSVPHC--ECGSEPSRTID-RTTADRDLEATIGRAEQGLDDRVGIVQEVGEIESFP
2036|gene|hla      ERTLLPVPGC--DCGADPGDALP-REHQERSLSDAIDRAERAVDPRIGLLSEVGEQESFP
13720|hp|hbo       ERTVLPVPDP-----VDRDRTVR-RDYRDAAVDDSLARAERALDDRTGLVAQVGERESFP
1410|hp|nrc1       ------------------------------------------------------------
2602|hp|nph        ARQVLPVPGC--SCGSRAGRQLE-LTHADRTLDESLSLAEGAFDERVGPITSVGEAESFP
                                                                               

10020|hp|hma       ------------------------------------------------------------
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        APYYIAQIASTESFSDTRAVEFAAGVDADWNIAYMKALGEALERYCAGVYRTEKF-IKAS
1628|hp|hhi        APYYLSTLAETAGFSDVSAAAKAAGVAIDWDTAFMKALGENYERYAAGVYRERNL-RHGT
2949|hp|hut        APYYLARNGDTEGFSDVSSTGPAAGVDVDWNGALMKALGEAYERYSAGVYRTDRL-QTAS
2036|gene|hla      VPYYVARVADTTPFSDARAAEFGGGVDAGWDAAFMKALGEGLERYAAGVYRGASF-TRAP
13720|hp|hbo       VPYYLAQTADTRGFSDARAAEFAAGVDPDWDAAFMKALGEALERYCAGVYRASEF-TVAP
1410|hp|nrc1       ----------------------------------MRAVGEALERYSAGVYRTREFETHTP
2602|hp|nph        VPYYLASLAATP-FSDADAPDHAAGVGLSWDPAFMKALGEGLERYSAAVYST---DRLLV
                                                                               

10020|hp|hma       MDSTANPVRVELFVRSLCPEAATQQQNYVLDRLQALEDAGCIE-----------------
5267|hp|hhi        ------------MLRDADTDSLD------WVYINS-------------------------
2793|hp|hwa        ENTQSAAVSPRRFVQPERTPTYDPSNPIPWVHGINLATDEHVALPATFVYHPPPQERYRP
1628|hp|hhi        VVDVPDAVAPDAFVRDEA--EWDDSTALPWVPAENLLTDERRSLPAETVHYPPPSNVVRP
2949|hp|hut        VEELDNPIAPSAFVTPEPPESDSIE----WIEGENLATSQSVQVPASVAMYPPAGDRFRP
2036|gene|hla      AANVPNPVAPDAFVRPESAEPYARDDRLPWVTGEHLGTGEVASLPAEFVHFPPPENRYRP
13720|hp|hbo       ERTRARPVSPARFVRPDSYRAPDAEEPIPWVDGENLATGDTVSVPAEFVHYPPPDTRHKP
1410|hp|nrc1       DHDAAVP--PSAFVRPASGAAGDTTQ---WVRGEHLQTGTDALLPAPRVVFPPPNPDSGH
2602|hp|nph        DPDRRVP--ADAFVAPEP--PGEVAY---WYPAEHLETGERTAIPSELVVFPPPETRIRP
                               ::                                              

10020|hp|hma       --------------------------DLSILIWGRRIEPRLAQR-----------TAEGR
5267|hp|hhi        ---------SHEYEATLAELREPAGRHSGRLI-----------------------AGDDY
2793|hp|hwa        AITTGLGLGNGGVEALCAGISEVIERDAAMLAWYSTFEPVKLTV-----------DDESY
1628|hp|hhi        ATTTGLGLGNTVTEALLTGLYEVIERDAAMLSWYSTFEPLRVAV----------DDHERY
2949|hp|hut        ANTTGLGFGNATVEALLSGLYEVIERDAAMLSWYSTFEPLALDV-----------GDGAF
2036|gene|hla      AITTGLGLGNSGPHAALSGLYEAIERDATMTSWYSTADPLGIEV-----------DDEGF
13720|hp|hbo       PITTGLGLGNSGTEALLSGLYEVIERDATILAWYSSFDPLKLDV-----------ADEGY
1410|hp|nrc1       PITTGLGLGTAGADALLSGLYEVIERDATMLAWYSTFEPLALAVPLPSDTADDDTPADAF
2602|hp|nph        AITTGLGLGNGTVEALCSGLYEVIERDAAMVSWYSTDDPMALAV-----------EDEGY
                                                                               

10020|hp|hma       HLLERLSMFEQWE-------RDSDVSLDAF-----DWQHPVTNMVSDESVNVITLPSLAL
5267|hp|hhi        KI--------------------VNGVIPAVHQFCAETDWRLASL----------------
2793|hp|hwa        RTLCQRARGVGLTVQTFLLTQDIDVPVIATAVYRDGAEWPQFAIGSDAGLDPVATAQGSL
1628|hp|hhi        DTLRRRAASEGLEVTALLLTQDVDVPVITVALEQ--DEWPRFALGTDADLDPGTAAVGAL
2949|hp|hut        ETLARRVRTEGLSVTPLLLTQDVDVPVVAVAVHRADGDWPRFALGSGAHLDPAAAARSAL
2036|gene|hla      AELEKRARTESLSVTPLLVTTDIDVPVVAVGVHR-EGDWPRFAAGSGADLDPAAAARSAL
13720|hp|hbo       RALVKRARSENLTATPLLVTQDVDVPVIAVAVHR-DGEWPQFAMGSGASLDVADAARSAL
1410|hp|nrc1       AALARRARAESLSVTPLLCTQDVDVPVVAVAVHR-EA-WPQFAVGSAADLNAEAAAADAL
2602|hp|nph        RTLAARAGSEGLSATALLLTQDVDVPVVAVCVHR-EGEWPRFAAGSAADLDPAAAARGAL
                                          :  : :         .                     

10020|hp|hma       AEYVDD---------------------------------DLQHVAPCTRDGTVYRVTDRV
5267|hp|hhi        ------------------------------------------------------------
2793|hp|hwa        AEALQNWMELRAMGKDGVADTDGAIDEYATFPGRVQKFIMTETTVAAKDIAPSPIPTGA-
1628|hp|hhi        EEALQNWMELDSMGPEAAMDAQGAIGRYAESPGEGADLTATETAVPLDSLGPDADLSGE-
2949|hp|hut        AEAVQNWFELRQMGPDGAADAGGAIGEYAAFPDIVADFVDAAGTVSADAVAPDEPLAGS-
2036|gene|hla      AEALQNWTELRSMGPDAAAKQGAAIGRHADFPAETRAFFDADATVPAESLGEPELSGG--
13720|hp|hbo       AEALQNWMELRSMGPERANAEKGAIGEYADFPDAARRFVNAGPAVPAASVGPDDVPSGK-
1410|hp|nrc1       AEALQNWMELRALGPEPASQESGAIGAYADRPPAAEAFIDADTTVPVDTVGPADPPTDPA
2602|hp|nph        EEALQNWLELRRMGRTQAESESGAIGDYAAFPEAARAFVDAETTIPAESVGPAERPSGK-
                                                                               

10020|hp|hma       SHLADTADIADEVGHERTVVQ---------------------------------------
5267|hp|hhi        --------TLETHGRRSYALRKA-------------------------------------
2793|hp|hwa        DALDSLIKHVTEADLDVYATRITTPDVSTLGFEAVRVLIPGAQPLFQQHSFFGERAKRVP
1628|hp|hhi        AELETLCDRAADAGLTPYGARLTTRDLEQLGFEAVRVVCPSAQPLFFGGSFFGERAEAVP
2949|hp|hut        EALSTVVDRVTAAGLSPYAVRLTPRDVEAMGFEAVRVLVPSAQPLFLGEPYFGDRLETVS
2036|gene|hla      DELAAVVDRAEAVGLEPYVARTTTRDLAALGFEAVRVLVPGAQPLFTGDPFFGDRARDVP
13720|hp|hbo       AELDAVVERVADAGLDPYAVRTTTTDVASLGFEAVRVLIPEAQPLFQGDPFFGARATSVP
1410|hp|nrc1       SELTAVLDAVADAGLDAYGARLTPRDIDAAGFEAVRVLVPAAQPLFVSEPRFGERARTVP
2602|hp|nph        AELTALVDRVSAAGLDAYGARLTPRDIEMLGFEAVRVVVPSAQPLFTGDAYFGDRARRVP
                                .      .                                       

10020|hp|hma       -----------------
5267|hp|hhi        -----------------
2793|hp|hwa        REFGFDAKLDRPFHPFP
1628|hp|hhi        ADLGFEPRLDREHHPFP
2949|hp|hut        DRLGFEARPDRPFHPFP
2036|gene|hla      RSMGFEPDLEKAYHPFP
13720|hp|hbo       EELGFEAELQKPYHPYP
1410|hp|nrc1       STLGFEPRLDRRFHPFP
2602|hp|nph        AELGFEPQLDRPYHPYP