HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0534COG0271KOG3348 KOG2313arCOG04647Stress-induced morphogen (activity unknown)BolA-like transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0534 nrc1 VNG1357 balR BolA-like transcriptional regulator
cHOG0534 hmu HMUK2050 Hmuk_2050 BolA family protein
cHOG0534 hma RRNAC1307 putative transcriptional regulator
cHOG0534 hwa HQ2473A bolA morphology/transcription regulator BolA family protein
cHOG0534 hla HLAC2203 Hlac_2203 BolA family protein
cHOG0534 hbo HBOR14200 Hbor_14200 transcriptional regulator, BolA protein family
cHOG0534 hut HUTA0204 Huta_0204 BolA family protein
cHOG0534 hvo HVO_2899 HVO_2899 conserved domain protein
cHOG0534 nph NP3780A bolA morphology/transcription regulator BolA family protein
cHOG0534 hhi 1898 HAH_1898 putative transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


11307|gene|hma      --MDEDAVAELIEEALP-EAQATVTTPRDPDDDK---HYAVRVVSPVFEGESLVDQHQLV
1898|gene|hhi       --MDEDAVAELIETELP-EAQATVTTPRDPDDDK---HYAVRVVSPAFEGESLVDQHQLV
1357|chp|nrc1       --MDLADIEARIEAGFEADCSATVSRARGPHDDD---HLEAVVVSPAFEGVSLVDQHDMV
3780|gene|nph       --MTPEDVEAEIEAALE-DCEATVSRARGKHDDD---HLEATVVSPAFEELSLVDQHQLV
2203|gene|hla       MTIDPAEIADLIEDGIP-DAVARVTTPRVHDDEDEDAHFAAWVVSPAFEGESLVDQHQRV
204|gene|hut        --MESAEVERRIEDAIP-DATATVTHPR-PNDTE---HLAATVVSPAFAEKTLVEQHEMV
2473|gene|hwa       --MDSAEVEAQIESEIP-DATATVSLPRTPDENHEDSHFAAVIVSPAFENKSLVEQHELV
14200|gene|hbo      --METSEVERLIEDGIE-DADASVSLPRVPDEDHEDAHFAAVVVSPAFEGKSLVQQHQMV
                      :    :   **  :  :. * *: .*   :     *  . :***.*   :**:**: *

11307|gene|hma      HDALGDHLTRDIHAIELTTLTPAEAE----------------------
1898|gene|hhi       HDALGDHLTRDIHAIELTTLTPEEAE----------------------
1357|chp|nrc1       YDALGDAMTTEIHALELTTRPRSDRDA---------------------
3780|gene|nph       YDALGEAMTTDIHALELTTRTPE-------------------------
2203|gene|hla       YDAVGDHMTRSVHALEIKTYTPEDYAEHGDGALNDDLREAGLFPIEGE
204|gene|hut        YDALEDALTTEIHALKVTTRTPEEAE----------------------
2473|gene|hwa       YDALGDAMTTEIHALEMKTYTPDEYDQTASVE----------------
14200|gene|hbo      YDALGESMTTDIHAMELKTYTPEEYGDAGE------------------
                    :**: : :* .:**:::.* .