HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0532COG0181KOG2892arCOG04299/3Porphobilinogen deaminaseporphobilinogen deaminase

HOG Organism Gene ID Name Annotation
cHOG0532 nrc1 VNG2330 hem3 porphobilinogen deaminase
cHOG0532 hmu HMUK1105 Hmuk_1105 porphobilinogen deaminase( EC:2.5.1.61 )
cHOG0532 hma RRNAC3086 hemC porphobilinogen deaminase
cHOG0532 hwa HQ3450A hemC hydroxymethylbilane synthase (porphobilinogen deaminase)
cHOG0532 hla HLAC2252 Hlac_2252 porphobilinogen deaminase
cHOG0532 hbo HBOR01430 Hbor_01430 hydroxymethylbilane synthase( EC:2.5.1.61 )
cHOG0532 hut HUTA0927 Huta_0927 porphobilinogen deaminase
cHOG0532 hvo HVO_0078 HVO_0078 hemC porphobilinogen deaminase
cHOG0532 nph NP1326A hemC hydroxymethylbilane synthase (porphobilinogen deaminase)
cHOG0532 hhi 340 hemC porphobilinogen deaminase
MUSCLE (3.6) multiple sequence alignment


2330|gene|nrc1      -----MSSQQIRLATRGSDLALRQAGEVVDTLEDRRHDVELVEVETEGDRVTDALISDLG
927|gene|hut        ---MSSRATTFRLATRGSDLALRQTGAIRDALESRRHEVELLEVETTGDELRDELIHRLG
3450|gene|hwa       MTTRSRTRGTLTLATRGSDLALKQATSVQEALTDERYEVDLIEVETRGDQIQDELIHQLG
1430|gene|hbo       -----MKRGTLRLATRGSDLALRQTASVRDTLADRRFDVELVEVETRGDQIRDELLHRLG
13086|gene|hma      ---MTTRGETLQLATRGSDLALRQAATVRDSLSSRRLAVELVEVETTGDQIRDELIHRLG
340|gene|hhi        ---MTTRGETLQLATRGSDLALRQAATVRDSLSSRRLSVELVEVETTGDQIRDELIHRLG
2252|gene|hla       ------MTDTLRLATRGSDLALRQAGTVRDALSSRRRDVELRRVETRGDQIPDEMIHRLG
1326|gene|nph       ------MTETIRLATRGSDLALRQAQRVADALDSRRRTVELVEVETTGDAVRDELIHRLG
                              : **********.*:  : ::* . *  *:*  *** ** : * ::  **

2330|gene|nrc1      KTGAFVRALDQEVME--GTVDAAVHSMKDVPTEVPEDLVVAAVPHRENPADVLVTPDGTD
927|gene|hut        KTGAFVHSLDERVRA--GEADAAVHSLKDVPTEDREGLTVAAVPERAPANDVLVTPDGTD
3450|gene|hwa       KTGAFVRALDKKVLDPTAEADAAVHSMKDMPTDSPDDLVVAGIPQRAPPGDLLITTDGQR
1430|gene|hbo       KTGAFVRALDERVLD--EEVDAAVHSMKDMPTEHPRDLVVAGVPERAPANDVLLTPDGTA
13086|gene|hma      KTGAFVRSLDEKVLD--GELDAAVHSMKDMPTERPERLVVAAVPERAAAEDVLVTPDGRS
340|gene|hhi        KTGAFVRSLDEKVLD--GELDAAVHSMKDMPTERPERLVVAAVPERAAAEDVLVTPDGRS
2252|gene|hla       KTGAFVRALDEEVLG--GDADLAVHSLKDVPTEGMDDMVIAGVPERAPSGDVLVHPDGLG
1326|gene|nph       KTGAFVRSLDEKVID--GDVDAAVHSMKDMPTEFPDELVVAGVPERASPGDVLVTPDGDT
                    ******.:**: *       * ****:**:**:    :.:*.:* *  . *:*: .**  

2330|gene|nrc1      LEDLPAGSVVGTASLRRGAQVQAHRPGLDVEPIRGNVGTRVEKLLAPALHREHERRTEAE
927|gene|hut        LDDLPEGATVGTSSLRRRAQLLAERPDLDVQPLRGNVDTRVEKLLAPTLKAEYTARL---
3450|gene|hwa       LSDLPSGATIGTSSLRRQAQLLDQRTDITVEPLRGNIDTRIEKLLAPSLQTEHEQRI---
1430|gene|hbo       FENLPAGSVVGTSSLRRKAQILSARPDLEVEPLRGNVDTRVEKLLAPTLQREHEARV---
13086|gene|hma      LEELPEGATVGTSSLRRKAQLLAERDDLTVEPLRGNVDTRLAKLLAPSLQQEHQERH---
340|gene|hhi        LDELPEGATVGTSSLRRKAQLLAERDDLTVEPLRGNVDTRIAKLLAPSLQQEHQERH---
2252|gene|hla       IEDLPSGSVVGTGSLRRTAQIKAARPDLVVEPLRGNVDTRVEKLLAPDLQAEHERRLIAS
1326|gene|nph       LDSLPDGATVGTSSLRRKAQLLAARPDLDVQPLRGNVDTRVQKLLAPSLQAEHERRL---
                    :..** *:.:**.**** **:   * .: *:*:***:.**: ***** *: *:  *    

2330|gene|nrc1      KEAQSRDAREQRRGDYTADIEAGVENLDTEDGEEGAADDGDDTASSSEFEQSVTEWFDSL
927|gene|hut        ----DAQESEE----------------TTENGDDETKATGQT------FEQSFDDWFNGL
3450|gene|hwa       -EAEQGEITNT----------------ENTGSDDEDIDRDETDKELPEFEQSIEAWFNEL
1430|gene|hbo       ------DDDSD----------------KKANSAEASASGEEYETD---FDRTIEEWFDDL
13086|gene|hma      ---EAEQEHEG----------------DAGDGDDADPDTDEEEEH--PYDRTVEEWFDDL
340|gene|hhi        ---EAEQEHKG----------------DAGDGDDADLDADEEEEH--PYDRTVEEWFDDL
2252|gene|hla       GEASAATAEGS----------------DDDDADDESADADEIDEE---FDRTVEEWFDSL
1326|gene|nph       ---------EA----------------EDDEGEAEDEDGDDADR----YDRPPEEWFDDL
                                                   .        :       ::..   **: *

2330|gene|nrc1      TPLQQSAMERDPDTEYDALVMARVGLERTGLLHHVGIEELSTGTHVPATGQGALCVTARR
927|gene|hut        AEIERKATAREVDTEYDAIVLAEAGLDRLGLTHHLDFQALPDEQFVPSPGQGVVAVVA-E
3450|gene|hwa       SEIERRALERSVETEYDAIVLAEAGLQRSGLIHHIEYVQLDTTTFVPAPGQGAIAITTQG
1430|gene|hbo       SEIERRSLERDVETEYDAIVLAEAGLKRSGLLHRVEYDRLPPTEFVPAPGQGAIAVTARR
13086|gene|hma      TEFERRAMERDPDVEYDAIVLAKAGLHRAGLTRYVGMSDLDPDQFVPAPGQGALAVTA-V
340|gene|hhi        TEFERRAMERDPDVEYDAIVLAKAGLHRAGLTRYVGMSDLDPDRFVPAPGQGALAVTA-V
2252|gene|hla       SDLERSAMERKVETEYDAIVLAEAGLRRSELFYEVPTTRLPREEFVPAAGQGAIAVTA-T
1326|gene|nph       AEIERQALGREIETRFDGIVLAEAGLQRTGLLAQVETERLP-ETFVPAAGQGALAVTA-C
                    : ::. :  *. :. :*.:*:* .** *  *   :    *    .**:.***.:.:.:  

2330|gene|nrc1      DSDVVDTLRDALEHVRTRVEVTAERVVLEELGGGCIAPIGVHALVQGDTIRTAVQVFSQD
927|gene|hut        EGEAAEAIRDIIDDARTRVEATVERTILETLGGGCVAPIGVRAVFQGRVVTTTVRVLAPD
3450|gene|hwa       EANATAQIREAIDHPRTRVETTVERTVLAELGGGCIAPIGVHATLQGEYVHVAAQVFASD
1430|gene|hbo       DHENLDRIQDALDDPRTRVTTTVERTVLAELGGGCIAPIGVHAKLQGEHVHVTARVLSTD
13086|gene|hma      DGDLALDIKDRLDDPQTRIETTVERTILEELGGGCVAPIGVHAQLEGGVVHTRVRVLSQD
340|gene|hhi        DGDLALDIKDRLDDPQTRVETTVERTILEELGGGCVAPIGVHAHLEGGVVHTRVRVLSQD
2252|gene|hla       DPDVIEDVRSAVDHPRTRVAVTVERTILGELNGGCVAPIGVSALVQGEHVHTRVRVLSTD
1326|gene|nph       DGDVGQTLQNELDHPRTRVETTVERTILGTLGGGCVAPVGIHAVVRGEYVQASVRVLSQD
                    : :    :.. ::  .**: .*.**.:*  *.***:**:*: * . *  : . ..*:: *

2330|gene|nrc1      GSEQVGETRELDAEQYATDARELAADLRDRGAADLIEDARTEA----------------
927|gene|hut        GTEEIADRRALPVEDHVDAARELGEDLADRGADEVIERAKEMAEADDT-----------
3450|gene|hwa       GTETVDGSRNLPVDAHADAAAQFANKLADRGADELIAAARVAADESSNTESTGE-----
1430|gene|hbo       GEEEVSASRNLPVHNHANAAAEFAESLASQGAADLISEARDDARDEEDEK---------
13086|gene|hma      GTEEVSVGRDVPAEYHIESAQDLAAELAEQGADDLIAEAKRDSTEADDDASTAREEDEE
340|gene|hhi        GTEEVSVGRDIPAEYHIDAAQDLAAELAEQGADDLIAEAKRDSTEADDDASTAREEDEE
2252|gene|hla       GTEEVADTRDLPIRSHAKAAEEFAADLADRGAAELIEAAREETRADEEADTDE------
1326|gene|nph       GTEEIEATRDLPIERHPEAAREFADELADRGAADLIQRARRDA----------------
                    * * :   * :    :   * ::. .* ..** ::*  *.  :