HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0531COG1171KOG1251 KOG1250arCOG01431Threonine dehydratasethreonine dehydratase

HOG Organism Gene ID Name Annotation
cHOG0531 nrc1 VNG2100 iluA threonine dehydratase
cHOG0531 hmu HMUK0834 Hmuk_0834 threonine dehydratase( EC:4.3.1.19 )
cHOG0531 hma RRNAC2508 ilvA2 threonine dehydratase
cHOG0531 hwa HQ1348A ilvA threonine dehydratase
cHOG0531 hla HLAC0349 Hlac_349 threonine dehydratase
cHOG0531 hbo HBOR27320 Hbor_27320 L-threonine ammonia-lyase( EC:4.3.1.19 )
cHOG0531 hut HUTA1526 Huta_1526 threonine dehydratase
cHOG0531 hvo HVO_0464 HVO_0464 ilvA threonine dehydratase
cHOG0531 nph NP1076A ilvA threonine dehydratase
cHOG0531 hhi 2939 ilvA2 threonine dehydratase
MUSCLE (3.6) multiple sequence alignment


349|gene|hla        ------------------------------------------------------------
2100|gene|nrc1      MLSRCPVLRRPIPHGTIDHLIRSRDCGTGTRVPRLTKPPLAVSLSLRFDRFYVRGRPTDS
1348|gene|hwa       ------------------------------------------------------------
27320|gene|hbo      ------------------------------------------------------------
1076|gene|nph       ------------------------------------------------------------
1526|gene|hut       ------------------------------------------------------------
12508|gene|hma      ------------------------------------------------------------
2939|gene|hhi       ------------------------------------------------------------
                                                                                

349|gene|hla        -------------------------MISLSDVREARERVGDVARHTPLERSRTFSEMSGA
2100|gene|nrc1      CHTLRSRVLRRSPPTVKPGPRIPASMLSLSDIRDARERVSETARHTPLEYSHTFSDLTGA
1348|gene|hwa       -----------------------------------------------MQRSPTFSSMTGA
27320|gene|hbo      -------------------------MISLADIEAARDRIDGVAKHTPLDYSHTFTEMTGA
1076|gene|nph       -------------------------MLELADVTAARPRVAETARQTPLEHSTTFSKRTGA
1526|gene|hut       -------------------------MLTREDVLVARDRVSETARHTPLERSYSLSAMTGA
12508|gene|hma      -------------------------MLSFEDVLAAQDTVSETARHTPLDYSHTFSAMTGA
2939|gene|hhi       -------------------------MLSFEDVLAAQDTVSETARHTPLDYSHTFSAMTGA
                                                                   :: * :::  :**

349|gene|hla        DVHLKLENFQRTGAFKIRGAMNRIATLSESEREAGVVTASAGNHAQGVALAADRAGVDAT
2100|gene|nrc1      DVRPKLECFQRTGSFKIRGATNRIRTLSADQQDAGVVTASAGNHAQGVALAASRSGVDSK
1348|gene|hwa       DIHLKLENTQRTGAFKIRGATNRIATLSADEQAAGVVTASAGNHAQGVALAASRAGVDAT
27320|gene|hbo      SVHLKLENHQRTGSFKIRGAMNRITTLSEAEKEAGVVTASAGNHAQGVALAATRAGVDSK
1076|gene|nph       DVRLKLENFQRTGSFKIRGATNKVALLEAADREAGVVAASAGNHAQGVALAASKAGVDAV
1526|gene|hut       DVHLKYETVQRTGSFKIRGATNRIATLTDEQQAAGVVAASAGNHAQGVALAATRMGVDST
12508|gene|hma      DIHLKLELFQRTGSFKIRGATNRIASLSDAEREAGVVTASAGNHAQGVALAATRIGVDSK
2939|gene|hhi       DIHLKLELFQRTGSFKIRGATNRIASLSDAEREAGVVTASAGNHAQGVALAATRIGVDSK
                    .:. * *  ****:****** *.:  *   :. ****:************** . ***: 

349|gene|hla        VVMPRFAPVSKVKATRGYGASVRLEGVDYDEAQAYAHELERKESRTYVHAFDDPVVMAGQ
2100|gene|nrc1      VVMPESAPISKIKATKSYGAEVVLHGADYDDAQAHAHELEAAEGRTYVHAFDDEYIMAGQ
1348|gene|hwa       IVMPEQAPVSKIEATERYGGDTVLQGTDYDEAQAYAHQLAEESGQTYVHAFDDKAVMAGQ
27320|gene|hbo      VVMPEHAPISKVKATRRYGAETVLYGADYDEAQQRAHEIEDEENRTYVHAFDDEYVMAGQ
1076|gene|nph       IVMPEHAPISKINATRSYGAEVRLHGIDYDAAAERAHEIEREEGRTFVHAFDDPAVMAGQ
1526|gene|hut       IVMPERAPVAKVKATRSYGGDVVLHGRDYDAAAERAHEIAEAEGRTYVPAFDDERVMAGQ
12508|gene|hma      IVMPERAPVSKVKATRSYGGNVVLHGRDYDAAAEHAHELEREEGRTYVHAFDDEKVMAGQ
2939|gene|hhi       IVMPERAPVSKVKATRSYGGNVVLHGRDYDAAAEHAHELEREEGRTYVHAFDDEKVMAGQ
                    :***  **::*::**  **... * * *** *   **::   ...*:* ****  :****

349|gene|hla        GTIGLEIVDDCPDLDTVVVPIGGGGLISGVAVAIKEQLPDVRVVGVQAEGAASAGESLKR
2100|gene|nrc1      GTLGLEIAADCPTVDTVVVPIGGGGLISGVATALKGELDDVRVIGVQAEGASTVARSLDK
1348|gene|hwa       GTIGLEIIEDCPDVETVVVPIGGGGLIAGIATAVTAHNPDIRVIGVQAEGAASARKSLAS
27320|gene|hbo      GTIGLEIVDDCPDVETVVVPIGGGGLISGISTAVKEQLSDVRVIGVEAEGASSVATSLQK
1076|gene|nph       GTIGLEIVEQCPDVETVVVPIGGGGLIAGVATAVKEQ-TDARVVGVQAEGAASAADSLEK
1526|gene|hut       GTLGLEIATDCPDVDTVVVSVGGGGLIAGVATALKAWNDDVRVIGVQAEGAASLPQSLEA
12508|gene|hma      GTIGLEIYEDLPGVDTVVVPIGGGGLISGIATALKGKDERIRVIGVQAEGASSVAESLEK
2939|gene|hhi       GTIGLEIYEDLPGVDTVVVPIGGGGLISGIATALKGKDESIRVIGVQAEGASSVAESLEK
                    **:****  : * ::****.:******:*::.*:.      **:**:****::   **  

349|gene|hla        GEVYEIDSVDTIADGIATRSIGEQTLEVMSEYVDEVVTVDDREIALALTLLLERSKTLVE
2100|gene|nrc1      GQPQAVDHVDTIADGIAVRQVGAQTFPVIQEHVDEVVTVSDDEIATALVLLLERGKTLVE
1348|gene|hwa       GSIHKLETVNTIADGIATRRIGDRPFAVIDDRVDDVVTVTDDEIAVAVTYILERSKTLVE
27320|gene|hbo      GSVHELDSVNTIADGIATRRVGDKPFEVIEKYVDEVVTVSDEEIAVTLTYLLERSKTLVE
1076|gene|nph       GEVVERDAVDTIADGIATRKVGDRTFDVIAERVDEVVTVSDDEIAHALTALLERSKTLVE
1526|gene|hut       GEIVEREAVETIADGIATRKVGELPFEVIQNRVDEVVTVPDSAIAVAVTTLLERTKTLVE
12508|gene|hma      GHRIERDSVETIADGIATRTVGEQTFEVISDRVDEVVTVSDSEIAVALTTLLERSKTLAE
2939|gene|hhi       GHRIERDSVETIADGIATRTTGEKTFEVISERVDEVVTVSDSEIAVALTTLLERSKTLAE
                    *     : *:*******.*  *  .: *: . **:**** *  ** ::. :*** ***.*

349|gene|hla        GAGAVALAAVLSEAFEYENDETIVAALCGGNIDLNRLGTVIRRGLVQMGRYLKITIDLKD
2100|gene|nrc1      GAGATALAAVLEDKFEYADGETIVPALCGGNIDLNLLTTVIVRGLVDQGRYVKIRTVLKD
1348|gene|hwa       GAGAVAMAAVLADAFDYSNDETIVPALCGGNIDMNRLTTVLIRGLVETGRYLRIRTVLED
27320|gene|hbo      GAGAVALAALLFEKFDFTKDEVIVPALCGGNIDMNQLTTVVMRGLVETGRYLKVRTVLKD
1076|gene|nph       GAGAVPLAAILERRFDYADDETIVPALCGGNIDLNVLTTVITRGLVERGRFLRIKTVLKD
1526|gene|hut       GGGAVPVAALLEGAFEYEADETIVPVLSGGNIDLNVLTTVIMRGLIETGRYLRIRTVLED
12508|gene|hma      GAGAVALAAVMEEKFDFEDDETIVPALCGGNIDLNTLTNVIMRGLVETGRYLKIRTVLQD
2939|gene|hhi       GAGAVALAAVMEEKFDFEDDETIVPALCGGNIDLNMLTNVIMRGLVETGRYLKIRTVLQD
                    *.**..:**::   *::  .*.**..*.*****:* * .*: ***:: **::.:   *:*

349|gene|hla        RPGELERVSSIVARTGANVYAVHHDRTSRDVAVNAAELELELETDDAEHAADIVDALEAD
2100|gene|nrc1      SPGSLNDLLATAAEERANIYAIQHDRTNRDIAMNATEVELDLETRGPEHVDRLLTRIQDE
1348|gene|hwa       YPGALEELVAILADYQANIYAIQHDRTSRTVEMNEADVEIDLETRGHDHIDTILSALRES
27320|gene|hbo      QPGALHDLLTIIAEEQANIYAIRHDRTSREIGMNETDVELDLETRGHDHVETLLSALREK
1076|gene|nph       RPGALQELVGLLVDHRTNIYAIEHDRASKDIAMNAAEVELDLETRGHDHVVELLDALEDA
1526|gene|hut       RPGALEELVEVISRERGNIYAIEHDRASRDIAMDDTVVDLDIETRGPDHVESLLDALEDS
12508|gene|hma      RPGALEELVEVLSREQVNIYGIEHDRTSRDVAMSSAEVELDLETRGHDHVAELIDALTDE
2939|gene|hhi       RPGALEELVEVLSREQVNIYGIEHDRTSRDVAMSSAEVELDLETRGHDHVDELIDALTDE
                     ** *  :         *:*.: ***:.. : :. : :::::** . :*   ::  :   

349|gene|hla        GYVVEVLS-------
2100|gene|nrc1      GFDVTVLNGPQIVSE
1348|gene|hwa       GYTVEVLV-------
27320|gene|hbo      GYRVDVLV-------
1076|gene|nph       GYAVEVLV-------
1526|gene|hut       GYEVEVLV-------
12508|gene|hma      GYEVDVLV-------
2939|gene|hhi       GYEVDVLV-------
                    *: * **