HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0530COG0498KOG2616arCOG01434Threonine synthasethreonine synthase

HOG Organism Gene ID Name Annotation
cHOG0530 nrc1 VNG2430 thrC1 threonine synthase
cHOG0530 hmu HMUK0782 Hmuk_0782 threonine synthase( EC:4.2.3.1 )
cHOG0530 hma RRNAC2667 thrC3 threonine synthase
cHOG0530 hwa HQ1042A thrC threonine synthase
cHOG0530 hla HLAC2719 Hlac_2719 threonine synthase
cHOG0530 hbo HBOR02880 Hbor_02880 L-threonine synthase( EC:4.2.3.1 )
cHOG0530 hut HUTA1493 Huta_1493 threonine synthase
cHOG0530 hvo HVO_2969 HVO_2969 thrC threonine synthase
cHOG0530 nph NP5280A thrC_1 threonine synthase
cHOG0530 hhi 3075 thrC3 threonine synthase
MUSCLE (3.6) multiple sequence alignment


2430|gene|nrc1      ----MTDLSLAGETPACATDGVWLACVECGGTLAPFADVVYRCPECSGLLEARYADYPGF
1493|gene|hut       ----MSYLEITQEEPTEATDGVWLTCIECGEHFPPFAGIRYTCDECEGLLEVRYADLPTF
5280|gene|nph       --MADLTLSPQRDAPAVSDGGVWLSCIECGHDHPPFEDIIYTCEECGGLLEARYETYPTF
12667|gene|hma      MVPTMADLQLTDDVPPVADDGVWLACIECGETFAPFDEIRYTCDHCDGLLEVRYDDLPTF
3075|gene|hhi       MVPTMADLQLTDDVPPVADDGVWLACIECGETFAPFDAIRYTCDDCDGLLEVRYDDLPTF
1042|gene|hwa       --MSLELSAAAPAIPPEATDGVWLADIETGETYAPFEEIRYTSDE-DNLLEVRYADLPTF
2719|gene|hla       --MDLAIDAPTPAAPDCADDGTWLACIECDETFAPFEAVRYTCDECDGLLEVRYDDPPTF
2880|gene|hbo       --MSLELTAPAPDVPDVADDGVWLECIETGETYAPFDEIRYTSDH-GHLLEVRYANPPTF
2969|gene|hvo       --MSLELTAPAPEEPSVAADGTWLECIACGAQFAPFEDVRYTCDDCDGLLEVRYASPPTW
                                  *  : .*.**  :  .   .**  : * .     ***.**   * :

2430|gene|nrc1      EAF------SG--RGVWRYADALPVDAGVSVQEGDTPLYEAPDVAAAAGVADVRVKHEGM
1493|gene|hut       ADFGDDESAFH--GGVWRYSDALPFDEGVSLPEGDTPLHNVPRLEDEIGVERLRVKHEGM
5280|gene|nph       EDF------EG--HGVWRYDAALPFEEGVTLPEGATPLHRVPRLESEVGVEALRIKHEGM
12667|gene|hma      DEF------EG--SGVWRYNAALPFEEGITLPEGDTPLHEMPRLKDDIGVDALRVKHEGM
3075|gene|hhi       DEF------DG--SGVWRYNAALPFEEGVTLPEGDTPLHEMPRLKDDIGVDALRVKHEGM
1042|gene|hwa       EDF----QGQG--RGVWRYHAALPFENGVSLPEGDTPLHRAPSIRDAAGVRSLRIKHEGM
2719|gene|hla       DDFGSGAASEGPDRGVWRYREALPFDLGVTLPEGGTPLHTVPRIEEAVGVETLRVKHEGM
2880|gene|hbo       EDF----QGQG--RGVWRYRSALPFEEGVSLPEGDTPLHEAPRLREDIGVNTLRIKHEGM
2969|gene|hvo       DDF------EG--RGVWRYNAALPFEEGVSLPEGATPLHEVPRLEADVGVETLRVKHEGM
                      *           *****  ***.: *::: ** ***:  * :    **  :*:*****

2430|gene|nrc1      NPTGSFKDRGMTVGVRVAERLGVDRLACASTGNTSAALAAYGGRADTPVLVLLPAGKVAA
1493|gene|hut       NPTGSFKDRGMTVGVRVAQEVGVGRLACASTGNTSAALSAYGSRAGLQVLVLLPAGKVAA
5280|gene|nph       NPTGSFKDRGMTVGVRVAQELGVGRLACASTGNTSAALAAYGTRADLETLVLLPAGKVAA
12667|gene|hma      NPTGSFKDRGMTVGVRVAQEVGVDRLACASTGNTSAALAAYGARGGMETLVLLPAGKVAA
3075|gene|hhi       NPTGSFKDRGMTVGVRVAQEVGVDRLACASTGNTSAALAAYGARGGMETLVLLPAGKVAA
1042|gene|hwa       NPTGSFKDRGMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMQTLVLLPAGKVAA
2719|gene|hla       NPTGSFKDRGMTVGVRVAEELGVGALACASTGNTSAALAAYGGRGGMETLVLLPKGKVAA
2880|gene|hbo       NPTGSFKDRGMTVGVRVAKELGVDRLACASTGNTSAALAAYGARGGMETLVLLPSGKVAA
2969|gene|hvo       NPTGSFKDRGMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMETLVLLPAGKVAA
                    ******************: :**. *************:*** *..  .***** *****

2430|gene|nrc1      GKIAQAALHGARICEVDGNFDDCLDVVAELAARGEAYLLNSLNPFRLEGQKTIAFEILEQ
1493|gene|hut       GKIAQASLHGARILEVDGNFDRCLDIVKDLADRGEAYLLNSLNPFRLEGQKTIGLEIMEQ
5280|gene|nph       GKIAQASLHNARILEVDGNFDACLDIVQDLADRGEAYLLNSLNPFRLEGQKTIGLEILES
12667|gene|hma      GKIAQASLHRARILEVDGNFDQCLDIVQDLAARGEAYLLNSLNPFRLEGQKTIGLEIMEE
3075|gene|hhi       GKIAQASLHRARILEVDGNFDQCLDIVQDLAQRGEAYLLNSLNPFRLEGQKTIGLEIMEE
1042|gene|hwa       GKIAQAALHDARILEVDGNFDDCLDIVQDLARRGEVYLLNSLNPFRLEGQKTIGLEILER
2719|gene|hla       GKIAQASLHGARILEVDGNFDACLDIVQELAARGEAYLLNSLNPFRLEGQKTIGFEILEE
2880|gene|hbo       GKIAQAALHDARILEVDGNFDSCLDIVQELAERGEVYLLNSLNPFRLEGQKTIGLEILEA
2969|gene|hvo       GKIAQASLHDARILEVDGNFDSCLDIVQDLAARGEAYLLNSLNPFRLEGQKTIGLEILEE
                    ******:** *** ******* ***:* :** ***.*****************.:**:* 

2430|gene|nrc1      SRTATGEWPDRIVLPVGNAGNTAALYKAFRELVAAGAMTDDEMPALTGVQAAGAAPMVEA
1493|gene|hut       FRDEEGAFPDRIVLPVGNAGNTAALYKAFRELEATGAIDEDQIPKITGVQAAGAAPMVEA
5280|gene|nph       FRDDYGRFPDRIVLPVGNAGNTAALYKCFRELVASGALEADAVPKLTGVQASGAAPMVEA
12667|gene|hma      FYADNGEYPDRIVLPVGNAGNTAALYKCFRELVKAGAITEEQVPKLTGVQAEGAAPMVEA
3075|gene|hhi       FYADHGEYPDRIVLPVGNAGNTAALYKCFRELVKAGAITEEQVPKLTGVQAEGAAPMVEA
1042|gene|hwa       FYEEYGRFPDRIILPVGNAGNTSALYKAFRELVQSGALRPSEVPKLTGVQAAGAAPMVEA
2719|gene|hla       FRDDYGTFPDRIVLPVGNAGNTSALYKAFRELVQSGALDVDEVPKLTGVQAEGAAPMVEA
2880|gene|hbo       FRDDYGRFPDRIVLPVGNAGNTSALYKAFRELVQSGALDPEQVPKLTGVQAEGAAPMVEA
2969|gene|hvo       FHEDYGSYPDRIVLPVGNAGNTSALYKAFRELVQSGALDVDDVPKLTGVQAEGAAPMVEA
                         * :****:*********:****.****  :**:  . :* :***** ********

2430|gene|nrc1      VEAGRGRTERWTDVETRATAIRIGNPVNAPKALPGVYETGGTAVAVSDDRITDAQRMLAG
1493|gene|hut       IEHDWDHIERWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVSDEEITDAQRSLAE
5280|gene|nph       VEEDLEDTRRWEDVETIATAIRIGNPVNAPKALPGIRETGGTAVAVDDDEITDAQRSLAA
12667|gene|hma      IENGYEDTRRWDDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDEEITEAQRDIAG
3075|gene|hhi       IENGYEDTRRWEDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDEEITEAQRDIAG
1042|gene|hwa       VEHGWSDIERWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVTDDEITVAQRDLAR
2719|gene|hla       IEEGNDEVRRWEEVETRATAIRIGNPVNAPKALPGIRNTGGTAVAVSDDEITDAQRDLAE
2880|gene|hbo       IENGWEDTKRWDEVETRATAIRIGNPVNAPKALPGIRETDGTAVAVSDEEITEAQRDLAG
2969|gene|hvo       IENGWDETRRWDDVETRATAIRIGNPVNAPKALPGIRETDGTAVAVSDEEITAAQRDLAA
                    :* .     ** :*** ******************: :*.***:** *: ** *** :* 

2430|gene|nrc1      DGIGVEPASAASVAGLLALRERGEISADERVVCLTTGHLLKDPAAAAAAGGDTTPVPADA
1493|gene|hut       EGVGVEPASAASIAGLRKLREEGVVTADEQVVCLTTGHLLKDPDAAAEAGTDPEPVPADT
5280|gene|nph       EGVGVEPASAASVAGLRKLRERGVVDDDEHVVCLTTGHLLKDPDAAAAAGNDPEPVANST
12667|gene|hma      EGVGVEPASAASVAGLRKLRREGEVDSDESVVCLTTGHLLKDPEAAAEAGNEPEPVANST
3075|gene|hhi       EGVGVEPASAASVAGLRKLRREGEVDSDESVVCLTTGHLLKDPEAAAEAGNEPEPVENST
1042|gene|hwa       EGIGVEPASAASVAGLKKLRGRSRIDSDEDVVCLTTGHLLKDPDEAFKAGGNPEPVGGDT
2719|gene|hla       EGVGVEPASAASLAGLRKLRREGVVEDDEQVVCLTTGHLLKDPDAAYEAGSDPEPVPNDV
2880|gene|hbo       EGIGVEPASAASVAGLQKLRHEGVVDPDEDVVCLTTGHLLKDPDAAFEAGGEPEPVANDT
2969|gene|hvo       EGVGVEPASAASVAGLRKLRAEGVVDADEQVVCLTTGHLLKDPDAAFEAGDDPEPVPNDT
                    :*:*********:***  **  . :  ** *************  *  ** :. **  ..

2430|gene|nrc1      DGVLDAL--------------------------------------------
1493|gene|hut       DDVLEHL-RS-----------------------------------------
5280|gene|nph       EAVLSHL-AE-----------------------------------------
12667|gene|hma      EAVLDLIEEPSSVTETIRRQASKAADAPLVPALVASGLGVAYLYRKLRSKK
3075|gene|hhi       EAVLDLIEEPSSVAQTVRRQASKAADAPLVPALVASGLGVAYLYRKLRSKK
1042|gene|hwa       DAVLEHIGAN-----------------------------------------
2719|gene|hla       DAVVEHL-RD-----------------------------------------
2880|gene|hbo       EAVLEHIGAE-----------------------------------------
2969|gene|hvo       EAVLEHL-AE-----------------------------------------
                    : *:. :