HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0053COG0330KOG3090 KOG2620 KOG3083arCOG01915/1Membrane protease subunits stomatin/prohibitin homologsbifunctional short chain isoprenyl diphosphate synthase

HOG Organism Gene ID Name Annotation
cHOG0053 nrc1 VNG0321 ids bifunctional short chain isoprenyl diphosphate synthase
cHOG0053 hmu HMUK2990 Hmuk_2990 band 7 protein
cHOG0053 hma RRNAC1803 hypothetical protein
cHOG0053 hwa HQ1492A stomatin-like protein
cHOG0053 hla HLAC2641 Hlac_2641 band 7 protein
cHOG0053 hla HLAC0606 Hlac_606 band 7 protein
cHOG0053 hbo HBOR24160 Hbor_24160 SPFH domain, Band 7 family protein
cHOG0053 hbo HBOR01890 Hbor_01890 SPFH domain, Band 7 family protein
cHOG0053 hut HUTA2911 Huta_2911 band 7 protein
cHOG0053 hvo HVO_0035 HVO_0035 stomatin-prohibitin homolog transmembrane
cHOG0053 nph NP1126A stomatin-like protein
cHOG0053 hhi 2330 HAH_2330 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1890|gene|hbo       ---------MSAQGPPDWLLTGIGLIVGFAAVLAVFGLDP-----VVLISVLALILLVAT
2641|gene|hla       MGTQGPRGDAFEIGKATGSIPDAVWQYTALAGALVVGFALLSQSLVYGVAALAVLVVAVT
321|gene|nrc1       -------------MYTALSVGTAGAAAADALPAAIFGGSL-----TTVVGLLLLVLLAVV
11803|hp|hma        -------------------------MFPATAPLQGLGGLV----GF--VTVIFLLIAIAL
2330|hp|hhi         -------------------------MFPATAPLQP-GGLI----GF--VTVIFLLIAIAL
606|gene|hla        ---------------------------MDPITLQS-GLGF----GLVSVGLLFLLLVVIT
1492|gene|hwa       ------------------MDIIVVTGQGAQLPIQA-GIGL----GTSLVGLLGLFLAIVT
24160|gene|hbo      ---------------------------MVLDPVVLQAGTL----GAYMVGLLVLLLAVVT
2911|gene|hut       --------------------------MLGTIPLQLGGAEL-----FPIVALVLLAIAVVT
1126|gene|nph       -------------------MPASAEYNGMLTPLQI-GETV-----IPVVALLLLVVAVVA
                                                        .           :  : : :    

1890|gene|hbo       VLSAIEIVNAYEKRALTVFGEYRGLLEPGLNIIPPFVARTYTFDMRTQTLNVPPQEAITE
2641|gene|hla       IVSAVEIVDAYDKEALTVFGEFRKLLEPGVHLIPPFVSRTYAFDMRTQTLDVPQQEAITR
321|gene|nrc1       VYETVQIVDAYEKQALTVFGEYRGLLEPGINVIPPFVSRTYTFDMRTQTIDVPRQEAITR
11803|hp|hma        VYSSVVIIRPYQKGAYTVLGTYRGVLDQGIHFIYPFVSDVTRFDMRTQTLDVPRQEAITR
2330|hp|hhi         VYSSVVIIRPYQKGAYTVLGTYRGVLDQGIHFIYPFVSDVTRFDMRTQTLDVPRQEAITR
606|gene|hla        LWQSFEIVDAYEKKTLTVFGEYRKLLEPGINLIPPFVSRTYAFDMRTQTLDVPRQEAITR
1492|gene|hwa       VYQMVEIVDAYEKEALTVFGEFRHLLEPGISFIPPFVSRTYAFDMRTQTLDVPRQEAITR
24160|gene|hbo      VYQMVEIVDAYEKKALTVFGEYRKLLEPGINFIPPFVSRTYAFDMRTQTLDVPRQEAITR
2911|gene|hut       VWQMVVITDATEKKALTVLGEYRKLLEPGIAFVPPFVSATHTFDMRTQTLDVPRQEAITR
1126|gene|nph       VYQAVEIVDAYEKRALTVFGEYRRLLEPGINFVPPFVSRTYTFDMRTQTLDVPRQEAITR
                    : . . *  . :* : **:* :* :*: *: .: ***: .  *******::** ***** 

1890|gene|hbo       DNSPVTADAVVYLRVKDAKKAFLEVDQYKTAVSYLSQTSLRAVIGDMELDETLSRREEIN
2641|gene|hla       DNSPVTADAVVYIKVMDAKKAFLEVDDYKNAVSNLAQTTLRAVLGDMELDDTLSRRDQIN
321|gene|nrc1       DNSPVTADAVVYIRVRDAKRAFLEVDDYKTAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
11803|hp|hma        DNSPVTADAVVYIKVMDPKKAFLEVDNYERAVSNLAQTTLRAVLGDMELDDTLNKRGEIN
2330|hp|hhi         DNSPVTADAVVYIKVMDPKKAFLEVDNYERAVSNLAQTTLRAVLGDMELDDTLNKRGEIN
606|gene|hla        DNSPVTADAVVYIKVMDAKKAFLEVDDYKKAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
1492|gene|hwa       DNSPVTADAVVYIKVMDAKKAFLEVDDYKKAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
24160|gene|hbo      DNSPVTADAVVYIKVMDARKAFLEVDDYKKAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
2911|gene|hut       DNSPVTADAVVYIKVMDAKKAYLEVDNYKRAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
1126|gene|nph       DNSPVTADAVVYIKVMDAKKAFLEVDNYKKAVSNLAQTTLRAVLGDMELDDTLNKRQEIN
                    ************:.* *...*:****:*: *** *:**:****:******:**..* :**

1890|gene|hbo       RRIHRELNEPTDEWGVEVESVEVSEVKPSADVQSAMEEQSSAERHRRAMILEAQGKRRSA
2641|gene|hla       DRINEELDEPTDEWGIRVEAVEVREVSPSQEVQRAMEQQTGAERRRRAMILEAQGERRSA
321|gene|nrc1       SRIRTELDEPTDEWGIRVESVEVREVNPSQEVQQAMEQQTSAERRRRAMILEAQGERQSA
11803|hp|hma        ARIRKELDEPTDEWGVRVESVEVREVNPSKDVQQAMEQQTSAERKRRAMILEAQGERRSA
2330|hp|hhi         ARIRKELDEPTDEWGVRVESVEVREVNPSKDVQQAMEQQTSAERKRRAMILEAQGERRSA
606|gene|hla        AKIRKELDEPTDEWGIRVESVEVREVNPSKDVQQAMEQQTSAERRRRAMILEAQGERRSA
1492|gene|hwa       SKIREELDEPTDEWGIRVESVEVREVNPSKEVQQAMEQQTSAERRRRAMILEAQGERRSA
24160|gene|hbo      ARIRKELDEPTDEWGVRVESVEVREVNPSQDVQQAMEQQTSAERRRRAMILEAQGERRSA
2911|gene|hut       AKIRKELDEPTDEWGIRVESVEVREVNPSKDVQQAMEQQTSAERRRRAMILEAQGERRSA
1126|gene|nph       AKIRKELDEPTDEWGIRVESVEVREVNPSKDVQQAMEQQTSAERKRRAMILEAQGERRSA
                     .*. **:*******: **:*** **.** :** ***:*:.***.**********:*.**

1890|gene|hbo       VERAQGDKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAIVDRGLESLQRIG
2641|gene|hla       IEQAEGDKQSNIIRAQGEKQSQILEAQGDAISTVLRARSAESMGERAIIERGMETLEEIG
321|gene|nrc1       IENAQGDKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAIIEKGMETLEGIG
11803|hp|hma        IETAEGDKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAVIDKGMETLAEIG
2330|hp|hhi         IETAEGDKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAVIDKGMETLAEIG
606|gene|hla        VEQAEGDKQSNIIRAQGEKQSQILEAQGDAISTVLRARSAESMGERAIIERGMETLEEIG
1492|gene|hwa       VEQAEGEKQSNIVRAQGEKQSQILEAQGDAISTVLRAKSSESMGERAVIERGMETLESIG
24160|gene|hbo      VEQAEGEKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAIIEKGMETLEHIG
2911|gene|hut       VEEAQGEKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAEAMGERAVIERGMETLEEIG
1126|gene|nph       IEKAEGDKQSNIIRAQGEKQSQILEAQGDAIGTVLRAKSAEAMGERAVIERGMETLEEIG
                    :* *:*:*****:******************.*****.*:*:*****:::.*:*:*  **

1890|gene|hbo       ESPSTTYVLPQELTSLLGRYGRRLTDASV--QEAPGLESQDFDMETRELLGLDDVDDIAE
2641|gene|hla       KGESTTFVLPQELTSLVGRYGKALSGSDV--QQMEGLESKEFDEETEKMLGLEDIESALE
321|gene|nrc1       EGESNTFVLPQEVTSLVGRYGKHLAGSDV-GDGGSDLESMAFDEETRELIGLDNIDEILN
11803|hp|hma        QGESTKFILPQELTSLVGRYGKHLQGSDV-KENGHSLEALDFDDETREMLGLDDIEKILG
2330|hp|hhi         QGESTKFILPQELTSLVGRYGKHLQGSDV-KENGHSLEALDFDDETREMLGLDDIEKILG
606|gene|hla        KGESTTFVLPQELTSLVGRYGKALSGSDV--QEMEGLDGKEFDADTRKMLGLDDIDEILG
1492|gene|hwa       EGESTTFVLPQELTSLLGRYGRQLTNSDV--QEEAGLESLDFDDETRELLGLDDIERILG
24160|gene|hbo      QGESTTFVLPQELTSLVGRYGRQLTDSDV--QEQAGLDSLDFDEETRELIGLDDIEEILG
2911|gene|hut       KGESTKFVLPQELTSLVGRYGKHLTGSDVQTDGESALEGLDFDDETREMLGLDDIEKILG
1126|gene|nph       KGESTTFVLPQELTSLLSRYGKHLTGSDA-ADQSQLLEGLEFDDEARELLGLDNIEEILG
                    :. *..::****:***:.***. * .:..  :    *:.  ** :: :::**::::    

1890|gene|hbo       GVESLTNGDTNNTEIRLEETEE---------------------N----------------
2641|gene|hla       QLDTVADSDLRTDETRDADTAR---DVDLARQEEETREADRDIE----------------
321|gene|nrc1       QITEEADVDPADLEEKAEAVQR-GEDAGLQDAGEVIEEMDAELD----------------
11803|hp|hma        QIDEEAEVDVEAMEEEAQKIKQ-GQDSGLDNADDVIEEMDAEID------------DDPG
2330|hp|hhi         QIDEEAEVDVEAMEEEAQKIKQ-GQDSGLDNADDVIEEMDAEID------------DDPG
606|gene|hla        QIEESAEMDVEELEKEAEAVKAGGAGADIKSADEVIQEMDEEAV----------------
1492|gene|hwa       QIDEAAEMDLEELEQEAEAIKA-GETNDIKDADQITAEKTEEMQ----------------
24160|gene|hbo      QIDEAAEMNVEELEQEAQAIKE-GADPDIKSPDEVVAEADAEDKSSIKEADEVVAEADGE
2911|gene|hut       QIDQEAEVDVAEMEEQAQAVKSGKETADIRDPDEVIEEMDNEFN----------------
1126|gene|nph       QIDEEAEVDPKEMEAEAQAIKSGEDPANIKDPDEVIAEMDEEMP----------------
                     :   :: :    *                                              

1890|gene|hbo       ---------------------
2641|gene|hla       ----LEAESERPGN-------
321|gene|nrc1       -----DGTEDTGA--------
11803|hp|hma        TTDVAGGPDDTTRTSEVDKDN
2330|hp|hhi         TTDVAGGPDDTTRTSEVDKDN
606|gene|hla        -----DEDVETERES------
1492|gene|hwa       -----DGETERAVETERE---
24160|gene|hbo      SNGSADGTSDEERETEKEV--
2911|gene|hut       -------TDE-----------
1126|gene|nph       ----EGGLDDADLERESN---