HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0526COG0020KOG1602 KOG2818arCOG01532Undecaprenyl pyrophosphate synthaseprobable undecaprenyl pyrophosphate synthetase

HOG Organism Gene ID Name Annotation
cHOG0526 nrc1 VNG1779 uppS probable undecaprenyl pyrophosphate synthetase
cHOG0526 hmu HMUK1548 Hmuk_1548 undecaprenyl diphosphate synthase( EC:2.5.1.31 )
cHOG0526 hma RRNAC1716 uppS undecaprenyl pyrophosphate synthetase
cHOG0526 hwa HQ3332A uppS di-trans,poly-cis-decaprenylcistransferase
cHOG0526 hla HLAC2063 Hlac_2063 undecaprenyl diphosphate synthase
cHOG0526 hbo HBOR07310 Hbor_07310 Undecaprenyl pyrophosphate synthetase( EC:2.5.1.31 )
cHOG0526 hut HUTA2829 Huta_2829 undecaprenyl diphosphate synthase
cHOG0526 hvo HVO_2315 HVO_2315 uppS undecaprenyl diphosphate synthase
cHOG0526 nph NP4550A uppS_1 di-trans,poly-cis-decaprenylcistransferase 1; (Z)-prenyl diphosphate synthase 1
cHOG0526 hhi 2250 uppS1 undecaprenyl pyrophosphate synthetase
MUSCLE (3.6) multiple sequence alignment


2829|gene|hut       ----MRSWIRKQATSVYERLLKREIDGGPTHIAVIQDGNRRYARKEGQETSAGHREGAET
11716|gene|hma      MYTTMLSRGKRLGYAAYERLLQWELSGTPDHVAVIMDGNRRYAEKQGTKKQEGHKEGAQT
2250|gene|hhi       ----MLSRGKRLGYAAYERLLQWELSGTPDHVAVIMDGNRRYAEKQGAKKQEGHREGAQT
4550|gene|nph       -----MAPGAGYLSRLYERLLEREVSAAPSHVAVIQDGNRRYAETQGEAATAGHRAGAET
3332|gene|hwa       --MSMFRRVRGVIQRAYVRALQRQITEGPTHVAIIQDGNRRYAREQGNDAHEGHREGAQT
7310|gene|hbo       ----MRQWLRRQFNGAYERMLRRELGGGPAHVAIIQDGNRRYARRRGDEAPDGHKEGAKT
2315|gene|hvo       ----MFGWVRRGFRRAYERVLDREIDDGPTHVAIIQDGNRRYARKNGDDAPDGHKAGAQT
1779|chp|nrc1       ----MRTRLWDAASAVYERLLTREIDGAPAHVAVIQDGNRRYAREHGDDPTDGYQSGART
2063|gene|hla       ----MLNRLRVLTERAYRRHLHREIEDVPTHVAIIQDGNRRYARERGDNAPDGHRAGAAT
                                    * * * .::   * *:*:* *******   *     *:. ** *

2829|gene|hut       TEALLEWCDELGIEELTLYAFSTENFDRPADQRAVLFDLIEDKLYDFADSDRVHEAGVRI
11716|gene|hma      TEALLNWCDELGIREVTLYTFSTENFDRDPEEREHIFDLVEQKLRTFADADRVHEAGVCI
2250|gene|hhi       TEALLNWCDELGVREVTLYTFSTENFDRDPEEREHIFDLVEQKLRTFADADRVHEAGVCI
4550|gene|nph       TERVLEWCADLGVEELTLYAFSTENFERPPDEREALFDLIAEKLREFADHEEVHDREVRI
3332|gene|hwa       TERVLEWCEELGIEELTLYAFSTENFTRPDAELQPLFDLIESKLYEFADAERTHENSVRI
7310|gene|hbo       AEQVLHWCEEFGVEELTLYTFSTENFDRPQEELEPLFDLIEEKLYEFADAERVHEAGVRI
2315|gene|hvo       TEDVLTWCEELGIEELTLYTFSTENFDRPEHERGPLFDLIEDKLYEFADSERVHDREVAV
1779|chp|nrc1       TERVLEWCSDLGVEELTLYAFSTENFERPPDQQQHLFDLLESKLREFADADRVHADRVRI
2063|gene|hla       TERVLDWCADLGVAELTLYAFSTENFERPDEELEPLFDLLETKLRDFADADRVHEQGVRV
                    :* :* ** ::*: *:***:****** *   :   :***:  **  *** : .*   * :

2829|gene|hut       RAIGETHRLPERVREAIDYAEAQTRGYDQFHLNIALAYGGRAELLGAVKDLAADVDRGDL
11716|gene|hma      RAIGETEMLPERVRDAIDYAEGRTAQYDQLNLNIALAYGGRAELLGAARDVAAAVENETL
2250|gene|hhi       RAIGETEMLPDRVRDAVDYAEGRTAQYDQLNLNIALAYGGRAELLGAARNVATAVEDGTL
4550|gene|nph       RAIGQTHRLPDRVREAAAYAERRTEGYDALRLNIALAYGGRAELLDVARDIAAEAAAGDL
3332|gene|hwa       GAIGDIDRLPQRVQSAVEYAESQTAAYDDFRLNIALAYGGRSELLRAARSVAHDVDAGEL
7310|gene|hbo       CTIGETDRLPPRVREAIEYAESRTRGYDGFCLNIALAYGGRAELLGAVRDVARDVTSGTL
2315|gene|hvo       RAIGEVHLLPDRVRDAVEYAESRTADYDGFTLNIALAYGGRAELLGAARDVCRAVERGDL
1779|chp|nrc1       RAIGDTGRLPQRVRDAITYAESRTAGYDGFTLNVALAYGGRDELLTAARGVADAVAAGDL
2063|gene|hla       RAIGDVDRLPERVRDAVDYAERRTADNDRFTLNVALAYGGRTELLDAATAIARDVDAGDL
                     :**:   ** **..*  *** .*   * : **:******* *** ..  :.  .    *

2829|gene|hut       DPATIDVETVENRLYEGPTRDVDLIIRTGGDERTSNFLPWHANGNEAAAYFCAPYWPEFR
11716|gene|hma      DPTDVSAETIEERLYEGPTRDVDLIVRTGGDERTSNFLPWHANGNEAATFFCTPYWPEFR
2250|gene|hhi       DPTDVSAETIEARLYEGPTRDVDLIVRTGGDERTSNFLPWHANGNEAATFFCTPYWPEFR
4550|gene|nph       DPEAVTVDEIESRLTAGPTQAVDLIIRTGGDERTSNFLPWHANGNEAAVYFCTPYWPEFS
3332|gene|hwa       DPSTVDAETVECRLSRHTTRDVDLIVRTGGDERTSNFLPWHANGNEAAVYFCAPYWPEFS
7310|gene|hbo       SPDDVTVEEIDSRLCQHPTRDVDLIIRTGGAERTSNFLPWHANGNEAAVYFCAPYWPEFS
2315|gene|hvo       SPDEVDVSAVDRRLSRKPVRDVDLIIRPGGDERTSNFLPWHANGNEAAVYFCAPYWPEFS
1779|chp|nrc1       DPADIDAQAIESRLHTSPVRDVDLIIRTGGDERTSNFLPWHANGSEAAVFFCTPYWPEFS
2063|gene|hla       DPTDVDVETVEERLYDRPVRDVDLIVRTGGDERTSNFLPWHANGNEAAVYFCAPYWPEFS
                    .*  : .. :: **   ... ****:*.** *************.***.:**:****** 

2829|gene|hut       KIDFLRAIRTYEHREDSWRQTRARRALTLVRAVSDRELHHAKSVLRRFRDSLP-------
11716|gene|hma      KVDFLRAIRTYQNREDSWRTTRAERSLALVRAIEQSELPTAKRMLGRFRDALP-------
2250|gene|hhi       KVDFLRAIRTYQNREQSWRTTRAERSLALVRAIEQSELPTAKRMLGRFRDALP-------
4550|gene|nph       RIDFLRAIRTYEAREASWERTRAKRAAALVRAFGDRELAEARRVVGQFRGSVP-------
3332|gene|hwa       KIDFLRGLRTYESREESWRQSRTKRAVALVRAVAKTEIEDARQVAGRLREQLS-------
7310|gene|hbo       KVDFLRGLRTYESREKSWQRTRTERAVALVRSVAETELAEARAVTARLREKLP-------
2315|gene|hvo       KVDFLRGIRTYESREQSWQRTRTERAVTLVRAVAEVELEDARTVAGRLREQLP-------
1779|chp|nrc1       KVDLLRAIRTYESRAASWRQTRAKRALALVRALG-SEVGEARRVLDRFKGALP-------
2063|gene|hla       EVEFLRAIRTYQSREESWRQARAERAVALVRAVAEVEIAEAHAVAGRLRDRLPLDADALA
                     :::**.:***: *  **  :*: *: :***:.   *:  *. :  .:.  :.       

2829|gene|hut       ---SRELEEVDVSIDTEHD---------------------PGGD
11716|gene|hma      ---STEREQLDEEY--------------------------DLAD
2250|gene|hhi       ---STEREQLDEEY--------------------------DLAD
4550|gene|nph       ---EGELDEVEDPSDRD-----------------------PSAD
3332|gene|hwa       ---PTGAREVSAELSRQHDSPTDSV---------------DSAD
7310|gene|hbo       ---SAGAEEVAAELERQGDT--------------------EAAD
2315|gene|hvo       ---SSGADEVSAELAKRTD---------------------ETAD
1779|chp|nrc1       ----DPPEDVEAET--------------------------QSAD
2063|gene|hla       AALPGDDEDAVEDRSEDGSPPETATENAGQTPTGERDAEPESAD
                            :                                 .*