HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0525COG0050KOG0460arCOG01562GTPases - translation elongation factorsGTP-binding protein homolog

HOG Organism Gene ID Name Annotation
cHOG0525 nrc1 VNG1676 gbp2 GTP-binding protein homolog
cHOG0525 hmu HMUK1813 Hmuk_1813 protein synthesis factor GTP-binding( EC:3.6.5.3 )
cHOG0525 hma RRNAC1619 gbp2 GTP-binding protein-like
cHOG0525 hwa HQ2800A translation elongation factor aEF-1 alpha subunit-like protein
cHOG0525 hla HLAC0070 Hlac_70 protein synthesis factor GTP-binding
cHOG0525 hbo HBOR10090 Hbor_10090 translation elongation factor 1A GTP binding domain family( EC:3.6.5.3 )
cHOG0525 hut HUTA1155 Huta_1155 protein synthesis factor GTP-binding
cHOG0525 hvo HVO_2575 HVO_2575 gbp GTP-binding protein-like
cHOG0525 nph NP1740A translation elongation factor aEF-1 alpha subunit-like protein
cHOG0525 hhi 2161 gbp1 putative GTP-binding protein/protein synthesis factor
MUSCLE (3.6) multiple sequence alignment


1676|gene|nrc1      MGRDRARLAAALERGEQEGGSVEFKERFSRDIHLAEGRLESLTAQLRHRILSGDGEAEYV
70|gene|hla         MSADRSALRRAIERGERDGGAIEFKERLTRRVHLVDGRMESLVAQLRHRILSGDGEATYV
1155|gene|hut       MTPDRAVLERAIERGEREGGSVEFKERLTRETHLVDGRLESLAAQLRHRVLSGDGEATYV
11619|gene|hma      MSPDRAVLRRALDRGEREGGSVEFKERLTEDLHLSEGRLESLAAQLRHRVLSGDGEATYV
2161|gene|hhi       MSPDRAVLRRALDRGEREGGSVEFKERLTEDLHLSEGRLESLAAQLRHRVLSGDGEATYV
1740|gene|nph       MSADRAALRSALEQGEREGGSVEFKERLTRGVHLADGRRESLVAQLRHRVLSGDGEATYV
2800|gene|hwa       MSADRAALEAALDRGEEEGGNVEFKERLSREVHLADGRLESLAAQLRHRILSGDGTAMYV
10090|gene|hbo      MSADRAVLHEALERGEEEGGNIEFKERLSRSVHLADGRLESLAAQLRHRVLSGDGTATYV
                    *  **: *  *::.** :** :*****::   ** :** ***.******:***** * **

1676|gene|nrc1      LGVTDDGGLAGVSQATFAETMDVLSLLADEAGAHIADVQTWGIDSVGD---APAGTDGIV
70|gene|hla         LGVTDDGGLAGIAPDAFSETMDVLSLLADEADAHIADVETWSAGSAGN-----GNTEGLV
1155|gene|hut       VGITDDGNLAGIDPEAFSESMDVLSLLADEAGAHIEDVETWGVDGEGNAVRGQSGERGIV
11619|gene|hma      VGVTDDGGLAGISPAEFSESMDVLSLLAEEAGAHIEEVKTWGVDGVSE--NGSTDTDGIV
2161|gene|hhi       VGVTDDGGLAGISPAEFSESMDVLSLLAEEAGAHIEEVKTWGVDGVSE--NGPTASDGIV
1740|gene|nph       VGVTDDGGVAGISPEAFSESMDVLSLLADEAGAHIDDVETWGVDG-----------GRLV
2800|gene|hwa       IGVTDDGGIAGISADAFSESMDVLSVLAEEAGAHIEDVETWGVGTETE--------RGRV
10090|gene|hbo      VGVTDDGGIAGISPDAFSESMDVLSILADEAGAHIEDVETWGVGEASS--------NGLV
                    :*:****.:**:    *:*:*****:**:**.*** :*:**. .               *

1676|gene|nrc1      GVATVQDGDGLAAGDDHIIVGTAGHVDHGKSTLVGSLVTGDADDGDGATRGFLDVQPHEV
70|gene|hla         GLATLREGGMFEADDDHLVIGTAGHVDHGKSTLVGTLVTGRADDGQGGTRGFLDVQPHEI
1155|gene|hut       GVATIREGAVMD-DDEHIVVGTAGHVDHGKSTLVGSLVTGQADDGQGGTRSYMDVRPHEV
11619|gene|hma      GVATVSEGSVLA-DDDHIVVGTAGHVDHGKSTLVGSLVTGDADDGEGGTRGFLDVQPHEV
2161|gene|hhi       GVATVSEGSVLA-DDDHIVVGTAGHVDHGKSTLVGSLVTGDADDGEGGTRGFLDVQPHEV
1740|gene|nph       GVATLSEGSVLNVDDDHIVVGTAGHVDHGKSTLVGSLVTGNADDGEGGTRGFLDVRPHEV
2800|gene|hwa       GVATLNEGSMLNVDDDHIVVGTAGHVDHGKSTLVGSLVTGTADDGQGQTRGFLDVQPHEV
10090|gene|hbo      GVATVKEGTALDADDDHIVVGTAGHVDHGKSTLVGSLVTGQADNGEGGTRGFLDVQPHEV
                    *:**: :*  :  .*:*:::***************:**** **:*:* **.::**.***:

1676|gene|nrc1      ERGLSADLSYGVYGFDGDG--PLRVRNPDRKDERAAVVEAADRVVSFVDTVGHEPWLSTT
70|gene|hla         ERGLSADLSYAVYGFDDDGDEPIRMDNPHRKSDRAQIVEEADRLVSFVDTVGHEPWLRTT
1155|gene|hut       ERGLSADLSYGVYGFDDDG--PVRMDNPDRKTDRARIVEEADRLVSFVDTVGHEPWLRTT
11619|gene|hma      ERGLSADLSYGVYGFDADG-EPIRMDNPHRKDDRARVVEESDRLVSFVDTVGHEPWLRTT
2161|gene|hhi       DRGLSADLSYGVYGFDEDG-EPIRMDNPHRKDDRARVVEASDRLVSFVDTVGHEPWLRTT
1740|gene|nph       ERGLSADLSYAVYGFDDDG--PVRMDNPHRKSDRARVVEEADRLVSFVDTVGHEPWLRTT
2800|gene|hwa       ERGLSADLSYAVYGFTDTD--TVHMDNPHRKSDRARVVEESDRLVSFVDTVGHEPWLRTT
10090|gene|hbo      ERGLSADLSYAVYGFDDDG--PIHLHNPHRKSDRARVVQESDRLVSFVDTVGHEPWLRTT
                    :*********.****   .  .:.: ** ** :** :*: :**:************* **

1676|gene|nrc1      IRGLVGQKLDYGLLTVAADDGPTKTTREHMGVLLATELPTIVAVTKTDLVDDDRVAAVER
70|gene|hla         IRGLVGQKLDYGLLVVAADDGPTKTTREHLGILLATELPTIVAITKTDAVSDERLTEVER
1155|gene|hut       IRGLVGQKLDYGLLTVAADDGPTKTTREHLGILLATELPTIVAITKADLVDEDRIATVER
11619|gene|hma      IRGLVGQKLDYGLLTVAADDGVTETTREHLGILLATDLPTIVALTKTDLVDGERVAEVER
2161|gene|hhi       IRGLVGQKLDYGLLTVAADDGVTETTREHLGILLATDLPTIVAITKTDLVDEERVAEVER
1740|gene|nph       IRGLVGQKLDYGLLAVAADDGPTKTTREHLGILLATELPTVVAITKSDLVDDERLREVER
2800|gene|hwa       IRGLVGQRLDYGLLVVAADDGPTKTTREHLGILLAMELPTVVAITKVDMVDTDRVAEVER
10090|gene|hbo      IRGLVGQRLDYGLLVVAADDGPTRTTREHLGILLAMELPTVVALTKTDAVSDERVLEVER
                    *******.******.****** * *****:*:*** :***:**:** * *. :*:  ***

1676|gene|nrc1      EVEALLRRTERAPLPVARHGVDAAVDELGDGVVPIVRTSAVTGDGLAVLDELFARLPKTT
70|gene|hla         EVESTLRDAGQTPLLVDRHGIDTAVAEVGDGVVPLLRTSAVTKEGIGTLDRLFETLPKRA
1155|gene|hut       EVERLLRDVEKTPLPVERHGVDAAIEEISETVVPVVTTSAVTGDGLDTLDELFERLPKTG
11619|gene|hma      SVEQALREVDKTPLRVERHGVDTAIDEISETVVPVVTTSAVTKAGLDALDEMFEALPKTA
2161|gene|hhi       DVEQALREVDKTPLRVERHGVDTAIDEISETVVPVVTTSAVTKEGLDDLDEMFEALPKTA
1740|gene|nph       EIGRMLRDADRTPLSVDRHGVEAALDEIDEQVVPVVTTSAVATDGLSVLDELFERLPKTG
2800|gene|hwa       AVERLLRDVGRTPFLIERHGVAAAVDELSDSVVPILRTSAVTMTGLDELDSMFESLPKTT
10090|gene|hbo      EVERLLRDVERTPLPVERHGVEAAVEEISSAVVPVVQTSAVTMDGLDELDSFFQRLPKTT
                     :   ** . .:*: : ***: :*: *:.. ***:: ****:  *:  ** :*  ***  

1676|gene|nrc1      A-ASGPFRMYVDRTYSVTGVGAVASGTVKSGTVEDGETLLLGPFPNGSFRTVEVRSIEMH
70|gene|hla         TPERETFRMYVDRSYKVTGVGAVASGTVNSGTVEAGDELLLGPMADSSFREVEARSIEMH
1155|gene|hut       GDETAQFRMYVDRSYNVTGVGAVASGTINAGRVEAGDELLLGPMADGSFREVVARSIEMH
11619|gene|hma      G-EVGDFRMYVDRTYNVQGVGAVASGTIKSGEVEAGDELLLGPMQDGSFQEVEVRSIEMH
2161|gene|hhi       G-EVGDFRMYVDRTYNVQGVGAVASGTIKSGEVEAGDELLLGPMQDGSFREVEVRSIEMH
1740|gene|nph       A-EDGSFSMYVDRTYNVTGVGAVASGTIRSGSVEAGDELLVGPLADGSFREVEARSIEMH
2800|gene|hwa       NHDRDDFRMYIDRTYSVTGVGAVASGTVGSGSVEAGDELQIGPMPDGSFRDVEVRSIEMH
10090|gene|hbo      SEAREDFRMYIDRTYSVTGVGAVASGTVNSGSVEAGDELLVGPMADGSFRQVEVRSIEMH
                          * **:**:*.* *********: :* ** *: * :**: :.**. * .******

1676|gene|nrc1      YHRVDSAQAGRIVGIALKGVSEEAIERGMVLLPGDADPTPVRAFDAEVMVLNHPTRIDAG
70|gene|hla         YHRVDKATAGRIVGIALKGVDESEIERGMALVPRDSDSEPVREFEAEVMVLNHPTRIQEG
1155|gene|hut       YHRVDEGRAGRIVGIALKGVEEQDVERGMVLLPRETDPQPVREFEAEVMVLNHPTRIGEG
11619|gene|hma      YHRVDEAKAGRIVGIALKGVREADIERGMVLLPSDADPSPVQEFEAEVMVLNHPTRIGDG
2161|gene|hhi       YHRVDEAKAGRIVGIALKGVREQDIERGMVLLPADADPSPVREFEAEVMVLNHPTRIGDG
1740|gene|nph       YHRVESASAGRIVGIALKGINEADLERGMVLLPRDADPEPVRAFEAEVMVLNHPTRIDDG
2800|gene|hwa       YHRVDRAEAGRIVGIALKGVDEEDIERGMALLPAENDPTAVRSFEAEIMVLNHPTRIRDG
10090|gene|hbo      YHRVDRAKSGRIVGIALKGVKESEIERGMVLLPADADPTPVRSFEADVMVLNHPTRIRDG
                    ****: . :**********: *  :****.*:* : *. .*. *:*::*********  *

1676|gene|nrc1      YEPVVHLETIGEAARFTPADGQLLPGDAGHTRVRFKFRPYLVEEGQRFVFREGSSKGVGT
70|gene|hla         YEPVVHVETVSEAAVFAPEGGRLLPGDTGRTTIRFKFRPYLIEEGQRFVFREGSSKGVGT
1155|gene|hut       YEPVVHLETISEAAAFYPEGGQLLPGDSGRARIRFKFRPYLVEEGQRFVFREGRSKGVGT
11619|gene|hma      YEPVVHLETVSEAAAFYPEGGQLLPGDAGKTRVRFKFRSYLVEEGQKFVFREGSSKGVGT
2161|gene|hhi       YEPVVHLETVSEAAAFYPEGGQLLPGDAGKARVRFKFRSYLVEEGQKFVFREGSSKGVGT
1740|gene|nph       YEPVVHLETVSETASIHPDGGQLLPGDTGTTTVRFKFRPYAVEEGQRFVFREGSSKGVGT
2800|gene|hwa       YEPVVHLQTASEAVIFHPDEGQLLPGDTGTATVEFKFRQYLVEEGQRFVFREGQSKGVGT
10090|gene|hbo      YEPVVHLETVSEAVVFHPDGGQLLPGDTGHATVEFKFRPYLVEKGQRFVFREGSSKGVGT
                    ******::* .*:. : *  *.*****:* : : **** * :*:**.****** ******

1676|gene|nrc1      VTDVVE------
70|gene|hla         VRDVE-------
1155|gene|hut       VTDVTGV----E
11619|gene|hma      VTDTDPA----E
2161|gene|hhi       VTDIDPA----E
1740|gene|nph       VTDIVET----E
2800|gene|hwa       VTDVTTHIDLSD
10090|gene|hbo      VTEIHEG-----
                    * :