HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0522COG2036KOG3467 KOG0869 KOG1745arCOG02144Histones H3 and H4archaeal histone A1

HOG Organism Gene ID Name Annotation
cHOG0522 nrc1 VNG0134 hpyA archaeal histone A1
cHOG0522 hmu HMUK0564 Hmuk_0564 Transcription factor CBF/NF-Y/histone domain protein
cHOG0522 hma RRNAC2301 hpyA histone A1
cHOG0522 hwa HQ1436A hstA histone
cHOG0522 hla HLAC0110 Hlac_110 Transcription factor CBF/NF-Y/histone domain protein
cHOG0522 hbo HBOR26820 Hbor_26820 archaeal histone-like protein
cHOG0522 hut HUTA2248 Huta_2248 Histone core domain protein
cHOG0522 hvo HVO_0520 HVO_0520 hpyA archaeal histone A1
cHOG0522 nph NP0316A hstA histone
cHOG0522 hhi 2753 hpyA histone A1/transcription factor CBF/NF-Y
MUSCLE (3.6) multiple sequence alignment


2248|gene|hut       MSVELPFAPVDSIIRRNAGGLRVSAEATEALTRRIQSRGATLAADAAEAASADGRKTLMA
134|gene|nrc1       MSVELPFAPVDSLIRGHAGDLRVSAGAAEELARRIQRHGAILAVDAAAAAREDGRKTLMA
12301|gene|hma      MSVELPFAPVDAVIRRNAGGLRVSADAAEELARRIQDHGASLAVTAATEATTDGRKTLMP
2753|gene|hhi       MSVELPFAPVDAVIRRNADGLRVSADAAEELARRIQDHGASLAVTAATEATTDGRKTLMP
316|gene|nph        MSVELPFAPVDTIIRRNAGQLRVSAEAAEELARRIQDHGAALAETAAERATADGRKTLMA
1436|gene|hwa       MSVELPFAPVDTIIRGKAGELRVSAGAAEELAHRIQTHGATLAVTAAEEADTDDRKTLMA
110|gene|hla        MSVELPFAPVDGIIRRNAGDLRVSADAAEELARRIQAHGAELAIDAAERATEDGRKTLMA
26820|gene|hbo      MSVELPFAPVDTIIRRNAGSLRVSADAAEELARRIQRHGSELAIDAAERAREDGRKTLMA
                    *********** :** :*. ***** *:* *:.*** .*: **  **  *  *.*****.

2248|gene|hut       MDF-GV-----GEVPEKDA-LELPIAPVDRIARLDIDDRYRVAMDARIALASILEREADD
134|gene|nrc1       SDFEGIVGPRDDTAPDRRGDLALPVAPVDRIARLEIDDRFRVSEDARVALAGVLEAYAAD
12301|gene|hma      ADF-GI-----EQVPEKDG-LELPVAPVDRIARLDIDDDYRVAMDARVALASLLETYADE
2753|gene|hhi       ADF-GI-----EQVPEKDG-LELPVAPVDRIARLDIDDDYRVAMDARVALASLLETYADD
316|gene|nph        EDF-GS-----TPG-DKDE-LELPVAPVDRIARLDIDDRYRVSMDARIALAGELEAYADT
1436|gene|hwa       ADF-GV-----RQVVPRRE-LELPIAPIDRIARLRIDNQYRVSMDARIALADILEDYANN
110|gene|hla        SDF-GV-----EQVISRED-LILPVAPIDRIARLRIDDRYRVGVDARIALADILEDYADN
26820|gene|hbo      EDF-DV-----EQVVSRAE-LELPVAPVDRIARLRIDDRYRVSMDARIALADILEDYADN
                     ** .           .   * **:**:****** **: :**. ***:***. **  *  

2248|gene|hut       VAAAASLLAEHAGRRTVKAEDVELYAQLTHYVE
134|gene|nrc1       IADGAAVLAEHAGRRTVQAEDIQTYVTL---VE
12301|gene|hma      TAAAAAALARHADRRTIKAADVETYFELEQYY-
2753|gene|hhi       TAAAAATLARHADRRTIKAADVETYFELEQYY-
316|gene|nph        VATAAAILARHADRRTVKADDIETYYELKPHFE
1436|gene|hwa       VADAAAILARHADRRTIQAEDIETYFQL---FE
110|gene|hla        VASAAATLARHADRRTVQAEDIETYFAL---FE
26820|gene|hbo      VADAAAKLARHADRRTIQAEDIETYFAL---FE
                     * .*: ** **.***::* *:: *  *