HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0520COG1499KOG2613arCOG04149NMD protein affecting ribosome stability and mRNA decayhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0520 nrc1 VNG2474 vng2474 no entry
cHOG0520 hmu HMUK1198 Hmuk_1198 NMD3 family protein
cHOG0520 hma RRNAC2903 nmd3 putative nonsense mediated mRNA decay protein
cHOG0520 hwa HQ3435A posible NMD protein affecting ribosome stability and mRNA decay
cHOG0520 hla HLAC2215 Hlac_2215 NMD3 family protein
cHOG0520 hbo HBOR01210 Hbor_01210 NMD protein affecting ribosome stability and mRNA decay
cHOG0520 hut HUTA1010 Huta_1010 NMD3 family protein
cHOG0520 hvo HVO_0100 HVO_0100 putative nonsense mediated mRNA decay protein
cHOG0520 nph NP1358A hypothetical protein
cHOG0520 hhi 172 nmd3 putative nonsense mediated mRNA decay protein/NMD3 family protein
MUSCLE (3.6) multiple sequence alignment


2215|gene|hla       ---MSESR-EFCPRCGDTVPERRE-PLP-----GDPGGRDALLCDDCYFEDFELVDAPDR
2474|chp|nrc1       ---MTDAGSSFCPECGDPVDSVGG---------DGATRREQSLCDSCYFAAFDLVDAPDT
3435|gene|hwa       ----MSSG-EFCPRCGDVISKQPS-SRP-----GAPHERDAVLCNDCYFADFELIDAPER
1010|gene|hut       ---MTRSG-AFCPRCGDAIESDPT-ERP---GQPGAHDPDSVLCDACYFEEFDLVDAPER
12903|gene|hma      ---MSRSG-EFCPRCGDEIPEGTD-ERPELAGAGGQRNSEHVLCDACYFEEFDLVDAPDT
172|gene|hhi        ---MSRSG-EFCPRCGDEIPEGTD-ERPELAGAGGQRNSEHVLCDACYFEEFDLVDAPDT
1210|gene|hbo       ----MSSG-DFCPRCGDPVPEREE-PLP-----GMPRDRDAVLCDACYFEDFDLVDAPER
1358|hp|nph         MSSGSRSG-EFCPRCGDEISRPSDIDLP-----SGPSDPDAVLCDGCYFEDFDLVDAPER
                          :   *** *** :                    :  **: ***  *:*:***: 

2215|gene|hla       IEVLVCSGCGAVRRGESWRDVGARDYTDVAVDEVAEALGVHVDAEDVEWGVEPEQVDENN
2474|chp|nrc1       IEVMVCARCGAVHRGNRWVDIGADDYVDVAVAETTEALGVHLEAEDVDWEVRPEKLDDNT
3435|gene|hwa       LEVQVCARCGAVKDGSQWVDVDADDYTEVAIDRITESLGVHLSAEEIQWGVEPEQVDENT
1010|gene|hut       IEVRVCSRCGAVHRGNRWLDVGAEDYTDVAIEETSESLGVHLDATDVSWQVAPEQVDRNT
12903|gene|hma      IQVRVCSRCGAVHKGNRWVDIGAEDYTDIAVEQVSEALGIHVDAQSVAWQVAPEQLDKNN
172|gene|hhi        IQVRVCSRCGAVHKGNRWVDIGAEDYTDIAVEQVSEALGIHVDAQSVAWQVAPEQLDKNN
1210|gene|hbo       IEVRVCSQCGAVHKGNRWVDVGARDYTDVAIEEVSEALGVHLKAEDVQWGVEPEQVDQNT
1358|hp|nph         IEVRVCSQCGALHRGNRWVDVGARDYTDIAVEETADRLAVHVDAREVDWGVEPEQVDQNT
                    ::* **: ***:. *. * *:.* **.::*:   :: *.:*:.* .: * * **::* *.

2215|gene|hla       VRMHCRFSGIVRGTLRSAEVTVPVKISRGTCDRCGRIAGGYYAGIVQVRADERDLTPAER
2474|chp|nrc1       VRMHATFTGVVRDTHRTEQVAVTVKVSRQTCQRCGRIAGESYASTVQVRAVGRDPTSEET
3435|gene|hwa       IRMHCTFSGVVRGTHQQERITVPVLISRQTCQRCGRIAGGYYASIVQVRARERTPTATEQ
1010|gene|hut       IRMHATFSGVVRGTAVTEEVVVPVKVSRQVCTRCGRIAGGSYASTVQVRARDRTPTDDEI
12903|gene|hma      IRMHAEFSGVIRGTPVTEEVTVPVRISRQTCKRCGKIAGGSFASIVQVRADGRDPTDDER
172|gene|hhi        IRMHAEFSGVIRGTPVTEEVTVPVRISRQTCKRCGKIAGGSFASIVQVRADGRDPTDDER
1210|gene|hbo       IRMHCSFSGFVRDTHIEETVTVPVKISRQTCKRCGRIAGGYYSSIVQIRAEERDPTKEEA
1358|hp|nph         IRMHCLFSGVIRGTAVSEEVTVPVYVARETCDRCGRIAGDYYASIIQVRGTDRTPTTDEN
                    :***. *:*.:*.*     :.*.* ::* .* ***.***  ::. :*:*.  *  *  * 

2215|gene|hla       AEALDIAETYVADQEADGDREAFITEVKETDDGPDIKLSSNRLAQNVATRITEALGGSFE
2474|chp|nrc1       DRAAELAHRIVADMEATGDREAFVTEIGDAESGTDIKLSTTKIGLKLARKLVEEFGGDFE
3435|gene|hwa       QRGVEIAESYIADRKATGDRDAFISEITTTDDGTDIKISTNQLGSGVAAQIVRELGGSVS
1010|gene|hut       ERAKAIAHEIVADMEATGARDAFVTEVGEDDDGVNIKVSTTNIGKQIASRIVGEFGGSFS
12903|gene|hma      ERAEEIAQEYVAAREETGDRNAFITETKSVDDGLDMKISTNQMGLGIAKRITAQLGGSYS
172|gene|hhi        ERAEEIAEEYIAAREATGDRNAFITETKSVDNGLDMKISTNQMGLGIAKRITAQLGGSYS
1210|gene|hbo       QRAVEIAESYIEEREETGDRNAFISEISNSGDGPNIKISTNQMGSGVAKHVVRELGGNVE
1358|hp|nph         DRAVEIAESYIAEREATGDRNAFITETSRTDDGVDMKISTNQMGQGIAKRIVAELGGTVS
                      .  :*   :   :  * *:**::*     .* ::*:*:..:.  :* .:.  :**  .

2215|gene|hla       SYPTLVTEDGDGNEVYRVTFAVRLPRYAAGEVIDPEDGD-GPVLVTSVSGRLRGVRLVTG
2474|chp|nrc1       DHETLITEDDDGNEVYRVTYAVRLPEFVPGDVVDIAADDGGPVLVQSNHGNLKGVRVTTG
3435|gene|hwa       EYPTLVTEDGDGNEVYRVTYAVRLPEFTPGDVIEPADEE-GPVVVRSVQGNLKGVRATTG
1010|gene|hut       DSETLITEDEDGNEVYRVTYAVRLPPYRPGEVIDPEDSD-GPVIVRSVQGNLKGTRLKTG
12903|gene|hma      DSRRLISEDEDGQELYRMTYAVRLPRYRQGEVIDPEDGD-GPVLVRSVQGNLKGVRLATG
172|gene|hhi        DSRRLISEDEDGQELYRMTYAVRLPRYRQGEVIDPEDGD-GPVLVRSVQGNLKGVRLTTG
1210|gene|hbo       EYPTLVTEDGDGNEVYRVTYAVRLPKFTPGEIIDPDDDD-GPVLVRSVRGNLKGVRLDSG
1358|hp|nph         EAPTLVTEDGDGNEVYRVTFTARLPPYTPGDVIDLDDGD-GPVLVTSAHGNLKGVRLATG
                    .   *::** **:*:**:*::.*** :  *::::    : ***:* *  *.*.*.*  :*

2215|gene|hla       AEYTSEFEDAAAPDATRLGRRDDAAETTVVTVEDENAIQVLDPVTYEAKTVPNPDFVDGD
2474|chp|nrc1       EPYEASFEDGDSPDARKLGAVADATEATVVTVEDDAAIQILDPDTYEAQTVARPDYVDPD
3435|gene|hwa       DSYEASFEDGIAPDAEHIGTVDDATETTVVAFEDTYAMQVLDPETYESKTVARPSYVDPD
1010|gene|hut       DAYEASFEAGNAPDARRLGDQSDGVETTLVAIEDDHAVQVLDPETYETKSIPRPDYLDAD
12903|gene|hma      EDYEASFEAGETPDARRLGFREDGQQTTLVAIEDERAVQVLDPETFESKTVPRPDYLDID
172|gene|hhi        EDYEASFEEGETPDARRLGFREDAQTTTLVAVEDDNAVQVLDPETFESKTVPRPDYLDTD
1210|gene|hbo       EQYESQFEEGETPDARRLGTVEDAAETTVVTVEDENAVQVLDPETYESKTIARPDYFDSD
1358|hp|nph         DRYEADFEEGIDPDARTLGTREDAESTTLVAVEDAHAVQVLDPETFESKTVPRPSYLDPD
                      * :.** .  ***  :*   *.  :*:*:.**  *:*:*** *:*::::..*.:.* *

2215|gene|hla       ADS----VLAFEHGGKVHLVPEE--------------
2474|chp|nrc1       AST----VPALKSRAGLHVLPDA--------------
3435|gene|hwa       AAT----VPVIKSHQGLYVLPTSMVKINNETESTDPQ
1010|gene|hut       AET----VPVLKSRAGLHVLPSGEADEINDE------
12903|gene|hma      ADE----VPVLKSHAGLHILPAADADTDE--------
172|gene|hhi        TDTDTDEVPVLKSHAGLHILPAEGDNTDTDE------
1210|gene|hbo       AAM----VHVLKSRSGLHILPDEAVENGETSD-----
1358|hp|nph         ADE----VPVLKHRQGLHVLPDDEL------------
                    :      * .::    ::::*