HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0052COG0281 COG0280KOG1257arCOG00853malate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0052 nrc1 VNG1624 mdh malate dehydrogenase
cHOG0052 hmu HMUK1754 Hmuk_1754 Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))., Phosphate acetyltransferase( EC:1.1.1.40,EC:1.1.1.39 )
cHOG0052 hma RRNAC1754 maeB malic enzyme
cHOG0052 hwa HQ2736A mdh malic enzyme
cHOG0052 hla HLAC1525 Hlac_1525 malate dehydrogenase
cHOG0052 hbo HBOR08740 Hbor_08740 allosteric NADP-dependent malic enzyme( EC:1.1.1.40 )
cHOG0052 hbo HBOR33170b Hbor_33170 allosteric NADP-dependent malic enzyme( EC:1.1.1.40,EC:1.1.1.39 )
cHOG0052 hut HUTA3014 Huta_3014 Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))., Phosphate acetyltransferase
cHOG0052 hvo HVO_2158 HVO_2158 mdh nadp-dependent malic enzyme
cHOG0052 nph NP0132A mdh_1 malic enzyme
cHOG0052 nph NP1772A mdh_2 malic enzyme
cHOG0052 hhi 2285 maeB malate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


3014|gene|hut       MGLEEDALDYHQREPPGKLEIATTKPTNTQRDLSLAYSPGVAGPCREIDADPADAFEYTA
1624|gene|nrc1      MGLDDDALDYHASDPPGKVEISTTKPTNTQRDLSLAYSPGVAAPCRAIADDPTEAFTHTT
33170|gene|hbo      MTLEDDAREYHRRIPPGKVEIATTKPTNTQRDLSLAYSPGVATPCRDIAENPEQAYRNTV
1525|gene|hla       MGLDDDAREYHRREPPGKIAIETTKPTNTQRDLSLAYSPGVAAPCRDIAAEPESVFEYTA
2736|gene|hwa       MGLEDDARDYHREDPSGKLEISTTKPTNTQRDLSLAYSPGVAAPCRDIAEDSTRGYEYTA
8740|gene|hbo       MGLDDDAREYHREEPPGKIEISTTKSTNTQRDLSLAYSPGVAAPCRDIADDADRAYEYTA
11754|gene|hma      MGLDEDALEYHRSKPPGKIEIATTKPTNTQRDLSLAYSPGVAAPCEEIDKDPEKAFEYTA
2285|gene|hhi       MGLDEDALEYHRSKPPGKIEIATTKPTNTQRDLSLAYSPGVAAPCEEIDKDPEKAFEYTA
132|gene|nph        MGLEEDALEYHRTDPPGKLEISTTKPTNTQRDLSLAYSPGVAAPCSEIADDPEAAYTYTT
1772|gene|nph       MGLDEDSLEYHRQEPPGKLEISTTKPTNTQRDLSLAYSPGVAAPCTEIADDPEDAYTYTT
                    * *::*: :**   *.**: * ***.**************** **  *  :.   :  *.

3014|gene|hut       KGNLVAVVSDGSATLGLGDIGPLASKPVMEGKGVLFKRFADIDVFDLEVDADDPERMIDV
1624|gene|nrc1      KGNMVGVVSNGSAVLGLGDIGAQAAKPVMEGKGVLFKRFADIDVFDIELDQATADELVAT
33170|gene|hbo      KGNLVGVVSNGSAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDIELDLDDPDTFTQA
1525|gene|hla       KGNLVAVVSNGSAVLGLGDIGASASKPVMEGKGVLFKRFADIDVFDIELDIEEVDPFCEA
2736|gene|hwa       KGNLVAVVSNGSAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDLELDLADPTDIINS
8740|gene|hbo       KGNLVGVVSNGSAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDVELDLEDPESIIET
11754|gene|hma      KGNLVGVVSDGSAVLGLGDIGPEAGKPVMEGKGVLFKRFADIDVFDVELDTDNAEAMIQT
2285|gene|hhi       KGNLVGVVSDGSAVLGLGDIGPEAGKPVMEGKGVLFKRFADIDVFDVELDTDNAEAMIQT
132|gene|nph        KGNMVGVVSNGTAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDIELDEDDPAAFAES
1772|gene|nph       KGNMVGVVSNGTAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDIELDQDDPDDIVTS
                    ***:*.***:*:*.*******. *.*********************:*:*      :   

3014|gene|hut       VEALEPTFGGVNLEDIGAPACFTIEKRLQESLSIPVFHDDQHGTAIITGAALLNAIDILG
1624|gene|nrc1      VSAMEPTFGGINLEDIKAPECFEVERRLGDAMDVPVFHDDQHGTAIISGAALLNAAEIAG
33170|gene|hbo      VAAMEPTFGGINLEDIKAPECFEIESDLSERMDIPVFHDDQHGTAIISGAALQNAADIVG
1525|gene|hla       VKAMEPTFGGVNLEDIKAPECFKIEERLREEMDVPVFHDDQHGTAIISGAALMNATEISG
2736|gene|hwa       VSAMEPTFGGINLEDIKAPECFEIESQLREEMDIPVFHDDQHGTAIISGAALLNAADIVD
8740|gene|hbo       VSAMEPTFGGINLEDIKAPECFEIESRLREEMSVPVFHDDQHGTAIISGAALLNAADIVD
11754|gene|hma      VEAMEPTFGGINLEDIAAPECFEVERRLSEKLDIPVFHDDQHGTAIISGAALVNAADIAD
2285|gene|hhi       VEAMEPTFGGINLEDIAAPECFEVERRLSEKLDIPVFHDDQHGTAIISGAALVNAADIAD
132|gene|nph        VARMEPTFGGINLEDISGPECFEIESYLREQMDIPVFHDDQHGTAIISGAALLNACEIAD
1772|gene|nph       VKAMEPTFGGINLEDIKAPECFEVEERLREEMDIPVFHDDQHGTAIISGAALLNACEIAD
                    *  :******:***** .* ** :*  * : :.:*************:**** ** :* .

3014|gene|hut       KDLSELEVVFSGAGASAIATARFFESLGVPGSAITMVDSGGIVTDERVDAGDVNEYKAEF
1624|gene|nrc1      KDLSDLDVVFSGAGASAIATAKFYVSLGVDREHITMCDSSGVITEDR----DVNEFKAAF
33170|gene|hbo      KNLSDLHVTFAGAGAAATATARFYVSLGIPRENITMCDIDGILSEARAEAGDLNEFTEPF
1525|gene|hla       KDLSEIDIVFSGAGASAIASARFYVSLGAKKENITMCDSSGIITEERVENGGVNEYKSQF
2736|gene|hwa       KDLSELNIVFSGAGASAISTARFYLSLGAKKENIIMCDSSGVISSDR---ESLNRYKSEF
8740|gene|hbo       KDLEDLNIVFSGAGASAIATARFYVSLGARKENIVMCDSDGVITPDR---EDINEFKAEF
11754|gene|hma      KELDELEVVFSGAGASAIASAKFYVSLGVSKDNITMCDSSGIITEERANHEELNRFKQEF
2285|gene|hhi       KDLEELEVVFSGAGASAIASAKFYVSLGVSKDNITMCDSSGIITEERATHEELNRFKQEF
132|gene|nph        KSISDLNITFSGAGAAATATAEFYVSLGVAPENITMCDIDGIITEDRVANDDPHSYVEPF
1772|gene|nph       KSLENLEIVFSGAGASAIATARFYVSLGVDPDNITMCDSSGIITESRADAGELNKHKQEF
                    *.:.:: :.*:****:* ::* *: ***   . * * * .*:::  *      : .   *

3014|gene|hut       ATEGP-AGDLADAMAGADVFVGLSVSGIVDGAMVASMAADPIVFPMANPDPEIDYDDAKA
1624|gene|nrc1      AQPADSGGDLADAMAGADVFVGLSVGGIVNQAMVRSMADDPIVFAMANPDPEIDYESAKA
33170|gene|hbo      ACGED-DGELEDAMEGADVFVGLSVGGIVSQEMVRTMADDPIIFAMANPDPEITYEDAKD
1525|gene|hla       ASDVE-GGDLADAMEDADVFVGLSVGGIVSQEMVRSMASDPIIFAMANPDPEITYEDAKD
2736|gene|hwa       AADVP-AETLAEAMEGADVFVGLSVGGIVSEEMIASMAADPIVFAMANPDPEIGYVEAKN
8740|gene|hbo       ANDVP-ADTLAEAMEGADVFVGLSIGGLVDQEMVASMADDPIIFAMANPDPEIGYEEAKA
11754|gene|hma      ARDIP-EGGLADAMDGADVFVGLSVGGIVDQEMVRSMASDPIIFAMANPDPEIAYEDAKA
2285|gene|hhi       ARDIP-EGDLADAMDGADVFVGLSVGGIVDQEMVRSMASDPIIFAMANPDPEIGYESAKA
132|gene|nph        AEPA--GGDLADAIAGADVFVGLSVGGIVSPEMVQSMAEDPIIFAMANPEPEIGYEAAKQ
1772|gene|nph       ASEGD-GGDLADAMAGADVFVGLSVGGLVDQEMVQSMAEDPIIFAMANPDPEIGYEAAKQ
                    *        * :*: .********:.*:*.  *: :** ***:*.****:*** *  ** 

3014|gene|hut       AGEGTTIVATGRSDYPNQVNNVLGFPFIFRGALDARARTINEEMKVAAAEALAALAREDV
1624|gene|nrc1      AREDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATDINEEMKVAAATALADLAKQDV
33170|gene|hbo      ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEEMKLAAADALADLAREDV
1525|gene|hla       ARDDTVIMATGRSDYPNMVNNVLGFPFLFRGALDVRATEINEEMKRAAAEALAELARKDV
2736|gene|hwa       ARDDTVVMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINETMKRAAAEALADLARQDV
8740|gene|hbo       ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEEMKRAAAKALADLARKDV
11754|gene|hma      ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEEMKVAAARALADLARQDV
2285|gene|hhi       ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEEMKVAAARALADLAKQDV
132|gene|nph        ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINQEMKVAAAEALANLAKQDV
1772|gene|nph       ARDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDARATEINEKMKVAAAEALADLAKQDV
                    * :.*.::********* *********:******.**  **: ** *** *** **.:**

3014|gene|hut       PDAVVKAYGDEPIQFGPEYVIPKPLDPRVLFEVAPAVARAAIESGVSRREPDLDTYVESL
1624|gene|nrc1      PDEVVKAYGDQPLQFGSEYIIPKPLDPRVLFEVAPAVADAAMETGVARTELDLVDYREEL
33170|gene|hbo      PDAVVKAYGDEPLQFGPDYLIPKPLDQRVLYEVTPAVARAAIESGAARTERDLDAYREEL
1525|gene|hla       PDAVVKAYGDDPLQFGADYVIPKPLDPRVLFEVAPSVAKAAMDSESARTEIDLEQYRERL
2736|gene|hwa       PDAVVKAYGEQPLQFGPEYLIPKPVDPRVLFEVAPAVAQAAIESGCARRDIDTDIYEEQL
8740|gene|hbo       PDAVVKAYGDQPLQYGPEYVIPKPLDPRVLFEVAPAVAQAAMDSGSARSELDTDEYEERL
11754|gene|hma      PDEVVKAYGDQPLQFGPNYIIPKPLDPRVLFEVTPAVAEAAIESGAARTELDTAAYVEEL
2285|gene|hhi       PDEVVKAYGDQPLQFGPDYIIPKPLDPRVLFEVTPAVAEAAIESGAARTNIDTEAYVEEL
132|gene|nph        PDAVVKAYGDQPLQFGPEYIIPKPLDPRVLFEVSGAVAEAAMESGVARDDLDLDTYREEL
1772|gene|nph       PDAVVKAYGDQPLQFGPEYIIPKPLDPRVLFEVAPAVAEAAMECGAARDDLDLDAYAERL
                    ** ******::*:*:*.:*:****:* ***:**: :** **::   :* : *   * * *

3014|gene|hut       EARLGKAREMMRIILNKAKSDPQRVVLAEGADDTMIRAAYQLLDRGIADPILVGDRTEIR
1624|gene|nrc1      EARLGKSREMMRIVINKAKSEQQRIALGEGGDEKMIRAAHQMHEAGIADPVLLGDRDTIQ
33170|gene|hbo      EARLGKSREMMRVVMNKAQSDPKRVALAEGENEKTIRAASQLVEDGIAEPVLIGRRDHIL
1525|gene|hla       EARLGKSREMMRVVLNKAKSDPKRIALAEGTDEKMIRAAYQLSEQGIAEPVLLGDADEIA
2736|gene|hwa       EARLGKSREMMRVVLNKAKSNPKRVALAEGHDEKIIRAAYQMHEQGIAQPILVGDKSEIV
8740|gene|hbo       EARLGKSREMMRVVLNKAKSDPKRVALAEGTDEKMIRAAYQLQEQGIAYPVLVGNREKIN
11754|gene|hma      EARLGKSREMMRVVLNKAKSDPQRVVLAEGHDEKMIRAAYQLVEQGIAEPILIGDADQIE
2285|gene|hhi       EARLGKSREMMRVVLNKAKSDPQRVVLAEGHDEKMIRAAYQLVEQGIAEPVLIGDADRIE
132|gene|nph        EARLGKSREMMRVVLNKAKSEPKRLVLAEGDDPKMIRAAYQLVEQGIAHPILVGDKRAIW
1772|gene|nph       EARLGKSREMMRVVLNKAKSDPKRLVLAEGDDEKMVRAAYQLVDQGIAHPILIGDKDVIW
                    ******:*****:::***:*: :*:.*.** : . :*** *: : *** *:*:*    * 

3014|gene|hut       SSADRLGLSFDPTIVDPGGDAVDCYADRLYELRKRKGVTRDEARELLT-DGNYLASAMVE
1624|gene|nrc1      GTVDALSLDFDPDVVDPDEGDHSAYADTLYDLRKRKGITRNEAESLVARDPNYLGSTMVE
33170|gene|hbo      QKTEELGLDFDPVVVNPREGEWTHYVDYLYEHRQRKGLTRTEANELIRQDSNYFASVMVE
1525|gene|hla       RTADRLGLSFQPEIVDPENRDVSAYGDQLYQLRKRKGITSREANELVRRDTNYLGSVMVK
2736|gene|hwa       ATASELGLEFGPEIVDPSDETWDHYTDRLYELRRRKGVTRNEAEELISGNSNYFASVMVE
8740|gene|hbo       QTAERLGLDFEPEVADPRNGDWDHYADRLYELRRRKGMTKNEAHELIRRDTNYFASVMVE
11754|gene|hma      STRRKFGLEFDPVVVDPETADVADYADRLYELRQRKGVTRREADELIR-DGNYLGSVMVE
2285|gene|hhi       STRRKFGLEFDPVVVDPETADVADYADRLYELRRRKGITRREADELIR-DGNYLGSVMVE
132|gene|nph        EQAAELGLDFDPEIVDPATDELDPYAERLYELRKRNGVTRREADGRVR-DGNYLASVMVE
1772|gene|nph       EHAQRLGLDFEPEIVDPEEGNLDPYAERLHELRQRKGVTRREADELIK-DGNHLGSVMVE
                         :.*.* * :.:*       * : *:: *.*:*:*  **   :  : *::.*.**:

3014|gene|hut       TGDADAMLTGATDHYPSALRPLLEVVGTAPDAEFAAGVYMLTFRNRVIFVADATVNPDPD
1624|gene|nrc1      AGDADAFLTGLTHHYPSALKPPLQVVGTAPDTDYVAGVYMLTFQNRVVFCADATVNQDPD
33170|gene|hbo      MGDADAMLTGLTNHYPSALRPPLQVIGTAENANYAAGVYMLTFRNRVVFCADTTVNLDPD
1525|gene|hla       SGDVDAMLTGLTHHYPSALRPPLQVVGSAADTDTVAGVYMLTFKNRVIFCADTTVNQDPD
2736|gene|hwa       QGDADAMLTGLTHHYPSALRPPLQVIGTAPEADYAAGVYLLTFKNQVVFAADTTVNLAPE
8740|gene|hbo       ENDADAMLTGLTHHYPSALRPPLQVIGTAPDADYAAGVYMLTFKNRVIFCADATVNLAPD
11754|gene|hma      MGDADAMLTGLTHHYPSALRPPLQVIGTADDADYAAGVYMLTFKNRVIFCADTTVNQDPD
2285|gene|hhi       MGDADAMLTGLTHHYPSALRPPLQVIGTADDADYAAGVYMLTFKNRVIFCADTTVNQDPD
132|gene|nph        MGDADAMLTGLTNHYPTALRPPLQVVGTADDADYAAGVYMLTFKNRVVFVADATVNQSPD
1772|gene|nph       MGDADAMLTGLMHHYPSALRPPLQIIGTDDESEYAAGVYMLTFKNRVVFIADATVNQSPD
                     .*.**:***   ***:**.* *:::*:  ::: .****:***.*.*:* **:***  *:

3014|gene|hut       AAVLAEVTKHTADVARQFNVEPRAALLSYSDFGSVEDDQTAIPREATRRLRDDPSVTFPV
1624|gene|nrc1      ADVLAEVAQHTADLARRFNVDPRVAVLSYSNFGSVDNEGTRKPRRAAQQLREDDDIDFPV
33170|gene|hbo      EEVLAEVTKHTAELAKRFNVEPRAALLSYSDFGSVETEGVRKPRNAVNILHDDPDVDFPV
1525|gene|hla       AETLAEVTRHTAELARRFNVEPRAAMLSYSNFGSVDNVGTRKPREAVDILHNDADVDFPV
2736|gene|hwa       ADVLAEITKHTASLARRFNIEPRAAMLSYSNFGSVENDGTKRLQDAVTSLHDDPAVDFPV
8740|gene|hbo       SDVLAEITKHTAELARRFNIEPRAAMLSYSNFGSVKNEGTRKPRDAVKLLHDDPEVDFDV
11754|gene|hma      TDVLEEVTRHTGELARRFNVEPRAAMLSYSNFGSVDNLGTKKIRRAVSRLQDDDRVDFPV
2285|gene|hhi       TDVLEEVTRHTGELARRFNVEPRAAMLSYSNFGSVDNPGTKKIRRAVSRLQDDDRVDFPV
132|gene|nph        EEVLAEVAQHTAELARQFNVDPRVALLSYSDFGTVDNEGTRKPRQAAEMLRDDDAVDFPV
1772|gene|nph       EDVLAEVTRRTADLARRFNVEPRAALLSYSDFGSVDNEGTRKPRRAAEMLRDDDAVDFPV
                      .* *::..*..:*..**::**.*:****:**:*.   .   . *.  *.:*  : * *

3014|gene|hut       DGEMQADTAVLEDALTDTYEFADLDEPANVLIFPNLEAGNVAYKLLQQLGGADAVGPMLA
1624|gene|nrc1      DGEMQADTAVVEDILQGSYEFSDLDTAANVLIFPNLEAGNIGYKLLQRLGGADAIGPMLV
33170|gene|hbo      DGEMQADTALVEEMLTETYEFAELDGPANVLVFPNLEAGNIGYKVLQRLGGAEAIGPMLV
1525|gene|hla       DGEMQADTAVVDDILNDTYEFSELDEAANVLVFPNLEAGNIGYKLLQRLGGAEAIGPMLV
2736|gene|hwa       DGEMQADTAVIEDILTETYDFSDLDEPANVLVFPNLEAGNIGYKLLQRLGGAEAIGPMLV
8740|gene|hbo       DGEMQADTAVVEDILEGTYEFSDLDDPANVLVFPNLEAGNIGYKLLQRLGGAEAIGPMLV
11754|gene|hma      DGEMQADTAVVEDILQDTYEFSELDDPANVLVFPNLEAGNIGYKLLQRLGGAEAIGPMLV
2285|gene|hhi       DGEMQADTAVVEDILQDTYEFSELDDPANVLVFPNLEAGNIGYKLLQRLGGAEAIGPMLV
132|gene|nph        DGEMQADTAVVEEMLTGDYSFADLDEPANVLVFPNLEAGNIAYKLLQRLGGAEAIGPMLV
1772|gene|nph       DGEMQADTAVVEDALQGTYDFSDLDEPANVLVFPNLEAGNIAYKLLQRLGGAEAIGPMLV
                    *********:::: *   *.*::** .****:********:.**:**.****:*:****.

3014|gene|hut       GMDRPVHVVQRGDDVEDIVNLAGVAVVDAQSEP-------
1624|gene|nrc1      GMNKPVHVLQRGDEVKDIVNLAAVAAADAQQRED------
33170|gene|hbo      GMDKPVYVLQRGDEVKDIVNLASVAVVDAQE---------
1525|gene|hla       GMDEPVHVLQRGDEVKDIVNLASVAVVDAQE---------
2736|gene|hwa       GMDKPVHVLQRGDEVKDIVNLAGVAVVDAQND--------
8740|gene|hbo       GMDKPVHVLQRGDEVKDIVNLAGVAVVDAQNE--------
11754|gene|hma      GMDKPVHVLQRGDEVKDIVNLAGVAVVDAQQE--------
2285|gene|hhi       GMDKPVHVLQRGDEVKDIVNLAGVAVVDAQQE--------
132|gene|nph        GMDKPVHVLQRGDEVKDIVNLASVAVVDAQNDASVDSIQH
1772|gene|nph       GMDKPVHVLQRGDEVKDIVNLAGVAVVDAQSNG-------
                    **: **:*:****:*:******.**..***.