HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0519COG0558KOG3240 KOG1617arCOG00670Phosphatidylglycerophosphate synthaseCDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase

HOG Organism Gene ID Name Annotation
cHOG0519 nrc1 VNG1030 pgsA CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
cHOG0519 hmu HMUK2373 Hmuk_2373 CDP-alcohol phosphatidyltransferase( EC:2.7.8.5 )
cHOG0519 hma RRNAC0532 pgsA CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
cHOG0519 hwa HQ3362A pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase
cHOG0519 hla HLAC1341 Hlac_1341 protein of unknown function DUF59
cHOG0519 hbo HBOR19280 Hbor_19280 phosphatidylglycerophosphate synthase( EC:2.7.8.5 )
cHOG0519 hut HUTA0365 Huta_0365 CDP-alcohol phosphatidyltransferase
cHOG0519 hvo HVO_1297 HVO_1297 pgsA CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidylt
cHOG0519 nph NP2144A pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
cHOG0519 hhi 1110 pgsA CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
MUSCLE (3.6) multiple sequence alignment


1341|gene|hla       -MTDPTADISDDAVDADETDETDEPNAQKSSADAVEVALRKVRDPEAGVSVFEAGVVEDV
3362|gene|hwa       MTLDQYRAVADRLLDP-FVDVVDRLGVSPNGVSLIAFGFAVG----AGGAFGIAT-----
19280|gene|hbo      MTLDQYRSVANRLLEP-FVGAADRLGLSPDGVSVVAFGFALA----AGVAFYLGG-----
365|gene|hut        MTLDQLRPLSDRLLAP-FVAASVRLGLTPNFISVLALLVAGG----AAGAFYLGGS----
2144|gene|nph       MTLDKLRPVAERVLNP-FVAAADRVGLTPDGVSVIAFGFAVA----AAAAYTAAGTAVVG
1030|gene|nrc1      MTLDQFRPLANRLLDP-WVRAAKTVGATPNTVSVAAFGLAVV----AAAAFYVGT-----
10532|gene|hma      MTLDKFRPLADRALGP-FVSAAKVAGLSPNGVSVIAFLLALG----AGGVYAVAAR----
1110|gene|hhi       MTLDKFRPLADRALGP-FVSAAKVAGLSPNGVSVIAFLLALG----AGGVYAVAAR----
                       *    :::  : .  .      .   .  .   . .       *.     .      

1341|gene|hla       TVADETATITADLREFPRDAVERVSAAMVRAASDAPGVSNARVEQVDPSPDLDGRSSGIE
3362|gene|hwa       ----ATTYVLGAVCVFWNGWLDLVDGALARERGVSSEGGDLLDHVLDRYADI--------
19280|gene|hbo      ----TMWYALGGLFVFLNGWLDLVDGALARAQGIASEGGDLLDHVLDRYADI--------
365|gene|hut        ---EPVWYVGAAGLVFANGWLDLLDGGIARELGTDSSAGDLLDHVFDRYADL--------
2144|gene|nph       VGPDPALYLLGALFVLGNGWMDLLDGALARRQGTDSKAGDLLDHVLDRYADI--------
1030|gene|nrc1      ----PAAYAVGAVCVFFNGWLDLLDGALAREVGTASEAGDLLDHVLDRYADV--------
10532|gene|hma      ---EPLLYLGGAVLVFLNGWLDLVDGALARELNVASSGGDLLDHVLDRYADI--------
1110|gene|hhi       ---EPLLYLGGAVLVFLNGWLDLVDGALARELNVASSGGDLLDHVLDRYADI--------
                              .    : .. :: :...:.*  .  .  .:     .*  .*:        

1341|gene|hla       TADRVIAVASTKGGVGKTTVATTLACALAAGDSDSQGSPSVGLFDADIYGPNVPEVIGAS
3362|gene|hwa       ----------------------AMLIGLAAG--------------SDAYALGFVAVTGVL
19280|gene|hbo      ----------------------AMLVGLAAG--------------IDAYGLGLAAVTGVL
365|gene|hut        ----------------------LLLVGLAAG--------------IDRWDLGVAAITGVL
2144|gene|nph       ----------------------VVVAGLAAG--------------AESYLLGLLAVTGVL
1030|gene|nrc1      ----------------------VVVTGAAAG--------------VDAFGLGLAAVTGVL
10532|gene|hma      ----------------------GIIVGLAAG--------------VSQWELGIAAVTGVL
1110|gene|hhi       ----------------------GIIVGLAAG--------------VSQWELGIAAVTGVL
                                           :  . ***               . :  ..  : *. 

1341|gene|hla       GPVYSDDDGNPVPVDAGGLEVMSMALLSDDGPLAWRGAMAHAALSDLFETTAWSGPDTVV
3362|gene|hwa       MTSYLGTQIQAV-----GLGREYGGLVGRADRLALIGITGVLAAVTTLPTV----PR---
19280|gene|hbo      MTSYLGTQIQAV-----GLGRAYGGLVGRADRLALIGLFAFVAA-----AA----PR---
365|gene|hut        MTSYLGTQAQAV-----GLDRVYGGLLGRADRLALMGFGALLAA-----VV----TD---
2144|gene|nph       MTSYLGTQAQAV-----GLDRVYGGLVGRADRLAVIGIVTAIAA-----GY----PE---
1030|gene|nrc1      LTSYLGTQAQAV-----GLDRVYGGLLGRADRLALVGVTAGVAA-----IT----PT---
10532|gene|hma      MTSYLGTQAQAV-----GLDRVYGGLLGRADRLALVGVVTGVAA-----FV----PN---
1110|gene|hhi       MTSYLGTQAQAV-----GLDRVYGGLLGRADRLALVGVVTGVAA-----FV----PN---
                     . * . : :.*     **     .*:.  . **  *     *            .    

1341|gene|hla       VDMPPGTGDVALTTLQEVPVDGVVLVTTPFHAAVSDTGRALELFEENDVPVLGVVSNMGE
3362|gene|hwa       ------------------YYLDLSVV-----------GWLLLFF-----AIVGHLTAI--
19280|gene|hbo      ------------------PVFGLSPV-----------GWLLALF-----AVIGHFTAL--
365|gene|hut        ------------------PVSGLSVI-----------GWLLVVF-----AVVGHLTAL--
2144|gene|nph       ------------------PLWTLSLV-----------EWLLVFL-----AVVGHLTAL--
1030|gene|nrc1      -------------------VAGYSPV-----------VALLVVF-----AVVGHLTAI--
10532|gene|hma      ------------------ALAGLTLV-----------GWLLVVF-----AVVGHVTAA--
1110|gene|hhi       ------------------ALAGLSLV-----------GWLLVVF-----AVVGHVTAA--
                                             :              * .:     .::* .:    

1341|gene|hla       FVCDECGTPHNLFGGDDPIEALDMPILAELPFDPEMQSTPAPRADALPEHADDLAAAVDE
3362|gene|hwa       -----------------------------------------------------------Q
19280|gene|hbo      -----------------------------------------------------------Q
365|gene|hut        -----------------------------------------------------------Q
2144|gene|nph       -----------------------------------------------------------Q
1030|gene|nrc1      -----------------------------------------------------------Q
10532|gene|hma      -----------------------------------------------------------Q
1110|gene|hhi       -----------------------------------------------------------Q
                                                                               :

1341|gene|hla       RYEEVWSVDPPADAVDLRGLDPETRTERVEERFRELDAGEECFIVSDRDPAPVRGFLLDL
3362|gene|hwa       RFYRAW---------------------------SDL------------------------
19280|gene|hbo      RFWGAW---------------------------SDLS-----------------------
365|gene|hut        RFYYAM---------------------------GDLAGNGSDPGEEST------------
2144|gene|nph       RFYHSM---------------------------RALS-----------------------
1030|gene|nrc1      RFVSAW---------------------------RQLA-----------------------
10532|gene|hma      RFYHAM---------------------------RALD-----------------------
1110|gene|hhi       RFYHAM---------------------------RALD-----------------------
                    *:                                 *                        

1341|gene|hla       VDADELPSFRVKRQNPETWFARATRP
3362|gene|hwa       --------------------------
19280|gene|hbo      --------------------------
365|gene|hut        --------------------------
2144|gene|nph       --------------------------
1030|gene|nrc1      --------------------------
10532|gene|hma      --------------------------
1110|gene|hhi       --------------------------