HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0518COG0398KOG3140arCOG04659hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0518 nrc1 VNG1641 vng1641 no entry
cHOG0518 hmu HMUK1761 Hmuk_1761 SNARE associated Golgi protein
cHOG0518 hma RRNAC1627 hypothetical protein
cHOG0518 hwa HQ2782A hypothetical protein
cHOG0518 hla HLAC1660 Hlac_1660 SNARE associated Golgi protein
cHOG0518 hbo HBOR08980 Hbor_08980 uncharacterized conserved protein
cHOG0518 hut HUTA1292 Huta_1292 SNARE associated Golgi protein
cHOG0518 hvo HVO_2517 HVO_2517 conserved hypothetical protein
cHOG0518 nph NP3350A hypothetical protein
cHOG0518 hhi 2168 HAH_2168 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


11627|hp|hma       -MDR-----LAKRQLIGTAGLVAVVAIVTTLLTPERVVAQLLHLADHPVYLAGVIVGLYL
2168|hp|hhi        -MDR-----LAKRQLVGTAGLVVVVAVATTLLTPERVVAQTTHLADHPVYLAGVIVGLYL
3350|hp|nph        -MHR-----ATVRQLFGAGVVAAIAAVAAISTSPQALFAAAERLVERPGLLAVTVVGLYL
1292|gene|hut      -MEP-----AVRRQLGAIALVALATAGVAVFGSLDALRSVVETAVGSPLAFAAVLLAVYA
1641|hp|nrc1       -MRR----------YAAWLAVGGGLAAAAVVVRPTRVLGALRHAAASP-WFPAVLVALYA
1660|gene|hla      MNRR-----TGVAGYVLAGVALAALSAVAWVVSPDAVLGPLTWLADDPVRFGAALIALTA
2782|hp|hwa        -MRRWICSLAEQRYRFMIGLIGVIVAAAIVTLSPTVVFDHITWIVADPVRVVLVTTGLAI
8980|hp|hbo        -MDR-----LRIDSRAAVGVLLFVVAAAAVLLSPEAVLSRAAWVAADPVRLVAATVALAI
                                            : .        :       .  *  .  .  .:  

11627|hp|hma       VRPFFAWPTMPLSAFVGFVLGVKYGFPVALMGALVTCLIPYRFAL----RAGEQGGMFGW
2168|hp|hhi        VRPFFAWPTMPLSAFVGFVLGVKYGFPVALMGALVTCLIPYRFAL----RAGEQGGMFGW
3350|hp|nph        VRPLLAWPISALSILLGYLLGVA-AAPIALAGAVVTTLPAYALAR----RLGHSEGVLAR
1292|gene|hut      VRPLVLWPVSLVSILVGYGLGIPLGVPVGLLGAVCTSLPAYLLAR----HAPRERGLFGR
1641|hp|nrc1       VRPFLAWPISALSLLVGFKYGLVVGVPVALAGAVATSLPPYLIGR----GAPRDGRVFGR
1660|gene|hla      IRPLLAWPTTLLAVVAGFGYGWA-GVPIGVAAMVATALPPYWLARAGRVRARDGSQIADR
2782|hp|hwa        VRPLLAWPTTFLAVLIGYGIGLG-GLPLALGLITFTSIPPYLLGR----QYDRA----TD
8980|hp|hbo        VRPLLAWPTTLLALVVGFGFGFA-GLPFALTLIVLTSVPPYLFAR----RYGRT----GR
                   :**:. **   :: . *:  *   . *..:     * : .* :.                

11627|hp|hma       LGDSGRRIIEVTGETRGVLAARLSPVPADPVSYGAGFARVSPRSFAVGTFIGEIPWVAVE
2168|hp|hhi        LGDSGRRIIEVTGETRGVLAARLSPVPADPVSYGAGFARVSPRSFAVGTFLGEIPWVAVE
3350|hp|nph        VGDAGAVVRRTTGDFRGIVAVRLAPLPTDPVSYAAGVAGVPLRPYVLGTAVGEAPWVLTA
1292|gene|hut      LHDRGSHVVETTGAFRGVAAARLLPLPADVISYGAGLSSVPTRAFVAGTLVGQLPWVLAG
1641|hp|nrc1       LSAGSRRYFDAAGGLRGLVAARIAPTPAEPVSAAAGAGGVTPRVFGIGTLVGELPWVVGA
1660|gene|hla      LCGAGERLADATGGVRAVTATRLLPVPSDAVSLAAGGSGIRLRSLLFGTALGELPWAIVG
2782|hp|hwa        HSKVGAEFIERTGDTRSVVATRLIPAPSDVVSVGAGIAGVSLIPFILGTIIGELPWAIAG
8980|hp|hbo        LAAAGESFVERTGDLRSVVLSRLVPAPSDVVSVGAGIAGVRFRWFVVGTAIGETPWAVAG
                       .      :*  *.:   *: * *:: :* .** . :       ** :*: **.   

11627|hp|hma       VTAGASLRSLTLTGLTIDALPHVLLFSAALAVLV-LAGPAYRHVSAPNSS---------
2168|hp|hhi        VTAGASLRSLTLTGLSVDALPHVLLFSAALAVLV-LAGPAYRHVSAPNSS---------
3350|hp|nph        VLLGASTSQLTTAGAAS--NPLLVVTALALAALLALSRPAYRRLADDRPLRT-------
1292|gene|hut      VVAGSSMRTLAVEGSAGGLP--LVVGAAAVGVLV-LASPVIRHIVDYDRLPSMGSSGSQ
1641|hp|nrc1       VAVGNTLDAFDPLG--ASVTPAYAIAGGAVAAAL-LAPIAYRRLRRA------------
1660|gene|hla      VAIGVSVDRLANGGTAS-IDPTVLVAMAGLGTLL-LAGPLYRTFIRDRASPTA------
2782|hp|hwa        VLAGASAETLTTLSLRTLIQPQLIAAGSIIAVIL-IGPPIWAWIRERRWELNY------
8980|hp|hbo        VLAGTSAESLATGDLAGAIDGRLVVAAALAAVLL-FAPTAYEWYDERADGSDSDAV---
                   *  * :   :   .                .. : :.