HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0516COG1967arCOG02177hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0516 nrc1 VNG1409 vng1409 no entry
cHOG0516 hmu HMUK2221 Hmuk_2221 Protein of unknown function DUF63
cHOG0516 hma RRNAC1003 yurM ABC transporter permease protein
cHOG0516 hwa HQ2794A hypothetical protein
cHOG0516 hla HLAC1178 Hlac_1178 Protein of unknown function DUF63
cHOG0516 hbo HBOR13710 Hbor_13710 predicted membrane protein, COG1967
cHOG0516 hut HUTA2950 Huta_2950 Protein of unknown function DUF63
cHOG0516 hvo HVO_2859 HVO_2859 Membrane protein of unknown function superfamily
cHOG0516 nph NP4190A hypothetical protein
cHOG0516 hhi 1629 HAH_1629 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10030|gene|hma      MSIRDGGFIDELRSTENSRIGLYALLLAGIAFYLFPVETAVMTMFKTESAFARTLPFAPP
1409|chp|nrc1       ---------MTFPDTTAERAWT-AAVGCVVVALVGGAVVFPDTVYGG---FVWQYFWGPV
4190|hp|nph         ---------MDSSDFDLARMWL-AVFVGGIVAIVAAAAAFPRRVYNG---FLWQYFWGPV
1178|gene|hla       ----MSTRVEERFGLSPERAWA-AVVGAVAALLAIGSAVFPRIVYDR---FIWQYFWGPV
2794|hp|hwa         ---MHMSTVAARLDTSPERLWV-STVSTTVAVLVIGSLVAPETIYDS---FLWHYFWGPV
13710|hp|hbo        -----MATVAERVGMDPERLWG-SAMVAVLVALIGGSLAFPELVYDR---FIWHYFWGPV
2950|hp|hut         -------MDETGFDLTPGRAWL-AVFAAGVVTIVGASIAFTRTVWDE---FIWQYFWGPV
1629|hp|hhi         ----METFERAVDEYGPGQLWV-GSFAAVLLVAVGAVMAAPQAVWDR---FLWQYFWGPV
                                      .    . .            .    ::     * .   :.* 

10030|gene|hma      GTDGFTLDALTTAWNTLRPGLVNSLLMA--IPATIVSALLGSMTAY-GLTTISWRGQVGV
1409|chp|nrc1       VADA------QGAHCAAWNGGAVELLAT--KGACA---GAGGPVAYPGYTLVSEVGYAAT
4190|hp|nph         DADA------HGAVCAVRSGGTTERLYS--RAACS---GAEGFVAEPGYTTVSTVSYAVV
1178|gene|hla       AADG------QGAQCAIHDAGGTELLGS--SSACTAAVEAGEAVAFPGYTTVSTVSYVVI
2794|hp|hwa         QADA------NSAVCAVRPGSTVQYLTS--TTACA---NATEPVAYPGYTLVSEVGYMIT
13710|hp|hbo        QADA------NSAVCAVRTGGVTQYLTS--ASACA---EAAEPVAYPGYTLVSEVGYMLT
2950|hp|hut         YADA------HNAGCAIKEGGQTLLGGSGFAENCGIAVEQGHIVAEPGYTLVSEAGYMVL
1629|hp|hhi         YADA------KAASCAEMTASGPQPLYD----GCRAAIQEGRLIAEPGYTIVSEIGYMLI
                     :*.        *  :   .                        *  * * :*  .    

10030|gene|hma      VVLIIAGIFIPYQAVLVPLA-QFWFQVLP-GLLNGFVNTV--------------------
1409|chp|nrc1       LLGALVGVHFLLERLRIADSLALVYALTPFVLLGGVVRVVEDANNAAELFGTTGQPFLSY
4190|hp|nph         LVFMLIGVLFLLRRLDIEMSPAFYFALFPYMLLGGALRTVEDVNVAF--RGEAVGMLIPY
1178|gene|hla       LLAMLIGVVFLLRRLDIGTELRFFYALFPFMLLGGALRTVEDSGVAA--MRAGVEPLIPF
2794|hp|hwa         LLVALIGVVFLLRQLKIGSDRQLFYALTPFIFFGGALRVIEDANDAV----PSADALISY
13710|hp|hbo        LLFALTGVVFLMRRLDIGTDRNFFYSLLPFMFFGGALRVVEDANDTA----AVAESIITY
2950|hp|hut         GLFFLIGVYLLLKNLDIDLDREFFYALFPFMLFGGVVRVVEDASDAA--VEAGVEPVLSY
1629|hp|hhi         LVYMLVGVYFLLERLDIAEDPKLYFAFVPFMLLGGALRTVEDATDRA--VDAGVSPIVEY
                     :  : *: :    : :     : : . *  ::.* :..:                    

10030|gene|hma      ---------------FGF----ITGGNW---------QYPSRNGYVQLLQLSITHAAY-G
1409|chp|nrc1       PANTLIISPVIYVVMFAVTLVAVVAAVAVARRTDAVETYHRPLAGIGCVLLAATLLGL-G
4190|hp|nph         PAVALIISPFIYFVMFGFTLAALVGGVWLEGR-GTLSRSETFLGGIGTAAVVAVVGWL-L
1178|gene|hla       PASALLISPFIYFIVFGVTLACVLAAYSLEGR-GVVDDYARPLFAMGAVALTVTFGYL-S
2794|hp|hwa         PLNTLVISPIIYFTVFAVTLVAVGFTVWAERR-GLVERYDRLLFITGTGVLALALGYLIS
13710|hp|hbo        PLNTLVISPVIYFTVFLVTLGAIAVAVALEHT-DVTDSYERPLFAIGVVVLGLTLAYLFS
2950|hp|hut         PFNTLFISPLVYFTVFGFAIAALVGSLRLADR-GVVASAERALGTVGAVAFGVTFGYL-T
1629|hp|hhi         PLSSLIISPVIYGTVFLLTLLVLVVCVDLEQR-GIVDSYYRTTGAVGSIFVAVTLLYL-T
                                   * .    :                           .  .      

10030|gene|hma      IPICTLLFRSYYQSISDEMIEAARLDGASAFSIYRNIILPLSLPMFAVTLIYQFTQVYND
1409|chp|nrc1       VLAASHDYITFIPVFTVLTLGGATVITAVTWAAARRWLPSVTSGTETVGAVVLWGHAIDG
4190|hp|nph         YVAGTTDIVEFYLLVPTIVLGGATLTTLVFWWVTERFVPGINEGTGAMGALVVWGHAVDG
1178|gene|hla       YLSATTDYVEFYPIILVLTLGIATAATAVTWKLATAYVPDIRQGTGVAGIVIIWGHAIDG
2794|hp|hwa         LVINSAPGVEFYPQVLLTVVIGATAVTGITWWVIKTFMPSINRGTEFVGLVILWGHAVDG
13710|hp|hbo        LAINGAQGVEFHPQVLVVMLAGATLSAAATWWLIERFAPQINSGTETIGLVIIWGHAVDG
2950|hp|hut         VLGLTVEHVDFLPHVLLIIVGGATVAAYGVYVLADRFAPYINSGTGYVGLVVLWAHAIDG
1629|hp|hhi         FVALTREYATLYPSVLITTVALASALSYGLYRLFESYRPALNDGTGYIGLLVIWGHAIDG
                                  .    :  *       :         :         :  : :. :.

10030|gene|hma      LLFALVL-----VNEPAS-----QVATQRLAALTGGVVQSFNTTMAGA-----IVAALPT
1409|chp|nrc1       VANVVGLDWGAELGYPRGDLISKHPLNAYIVDATNAVLPQSVTHLIGDTWPFILLKVAAV
4190|hp|nph         VANVLSLDWGEQLVGVP--YGSKHVINEATVRITGAIQPQWLTDAVGSAWPFFFIKVIAA
1178|gene|hla       VANVIGLNWMPALTGTAN-LVPKHVVNALIVDWTGRLLPQSIVSVTGDAWPFLLVKLAAA
2794|hp|hwa         VANVIGLDWMRAIGAGPN-LVPKHPVNQFVVDVTGSVLPTSVLAITGDTWPFLLIKLLAA
13710|hp|hbo        VANVIGLDWMTELGAGPN-LVPKHPVNQFVVDFTASTLPAPIHAITGDAWPFLLVKLVAA
2950|hp|hut         VANVLITDWADALGLPVS-YYPKHPANEIIMNVTEAVLPAGIFDAIGSAWPFLVVKLGMA
1629|hp|hhi         VANVLLADWLDALNVPLT-YYPKHPANAFIIEATESLQSAGLTAAIGTSWPFLIVKLAVA
                    :  .:       :          :  .      *            *      .:    .

10030|gene|hma      LLVYIMFGEQF---------------------------AKGVAGE
1409|chp|nrc1       LFVLSLFNEELRADAPRYTTLMLVAVLAVGLGPGTRDMIRATFGI
4190|hp|nph         VVVVWVFNEEIFEESPRYAYLLFIAVLAVGLGPGTRDMLRATLAI
1178|gene|hla       TFVVWVFNGEMFDESPRYTLLLLITVLAVGLGPGSRDMLRATFGI
2794|hp|hwa         TFVIWVFEPEIFEESPRYTMLLLIAVLAVGLGPGTRDMLRATFGV
13710|hp|hbo        TFVVWVFEEGIFEESPRYTMLLLIAVLAVGLGPGTRDMLRATFGV
2950|hp|hut         LGIVWLFDEAFIEENPRYSYVLLVGVVAVGLGPGSRDMLRAAFGI
1629|hp|hhi         SLVVSLFNQEFIDDSPRYALLLLIAVTAVGLGPGTRDMLRATFGI
                      :  :*   :                            ... .