HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0515COG0540Aspartate carbamoyltransferase catalytic chainaspartate carbamoyltransferase catalytic subunit

HOG Organism Gene ID Name Annotation
cHOG0515 nrc1 VNG6309d pyrB aspartate carbamoyltransferase catalytic subunit
cHOG0515 hmu HMUK2301 Hmuk_2301 aspartate carbamoyltransferase( EC:2.1.3.2 )
cHOG0515 hma RRNAC1225 pyrB aspartate carbamoyltransferase catalytic subunit
cHOG0515 hwa HQ1879A pyrB aspartate carbamoyltransferase catalytic subunit
cHOG0515 hla HLAC1285 Hlac_1285 aspartate carbamoyltransferase
cHOG0515 hbo HBOR17830 Hbor_17830 aspartate carbamoyltransferase( EC:2.1.3.2 )
cHOG0515 hut HUTA0520 Huta_0520 aspartate carbamoyltransferase
cHOG0515 hvo HVO_1454 HVO_1454 pyrB aspartate carbamoyltransferase
cHOG0515 nph NP3518A pyrB aspartate carbamoyltransferase catalytic subunit
cHOG0515 hhi 1819 pyrB aspartate carbamoyltransferase catalytic subunit
MUSCLE (3.6) multiple sequence alignment


1879|gene|hwa       --------------------------MHQ-----DHLLSTTQLSREDIETILDRAAAIEM
6309|gene|nrc1      MLSTDAVETFDQLVVHDRKEDSSHLDRRHRVMDLDHIITSKQLSRADIETVLDRAAEIDA
1285|gene|hla       --------------------------MRQ-----DHLITATQLSRDDIEAVLDRAREVAD
17830|gene|hbo      --------------------------MRQ-----DHLISATQLSRDDVEAVLDRAADIDA
520|gene|hut        --------------------------MRH-----DHIISAKQLSRSDIEEVLDRAAEIAR
11225|gene|hma      --------------------------MRH-----DHIISAKQLSRGDIETVLDHAADIAA
1819|gene|hhi       --------------------------MRH-----DHIISAKQLSRGDIETVLDHAADIAA
3518|gene|nph       --------------------------MRH-----DHLLSAKQLSRGDIEGVLDRAAEIAA
                                               .:     **::::.**** *:* :**.*  :  

1879|gene|hwa       NPDGWEAQYSGTVLGLCFFEPSTRTRMSFDAAMKRLGGRTIDMGSVDNSSISKGETLADT
6309|gene|nrc1      DPSAFADRYENTVLGLLFFEPSTRTKMSFDTAMKRLGGDIVDMGSVDSSSVKKGETLADT
1285|gene|hla       DPAAYADRHAGSVLALCFFEPSTRTRMSFDSAAKRLGMNTIGMGDVDSSSVSKGESLSDT
17830|gene|hbo      DPAAWRQRHAGTVLGLCFFEPSTRTRMSFDTAMKRLGGRTVDMGPVESSSVKKGESLADT
520|gene|hut        DPTAFRQRHPGALLGLLFFEPSTRTKMSFSASIKRLGGDIVDMGPVEYSSVKKGESLADT
11225|gene|hma      DPGAFADRHSDTLLGLLFFEPSTRTKMSFTTAMKRLGGDIVDMGSVESSSVKKGESLADT
1819|gene|hhi       DPGAFADRHSDTLLGLLFFEPSTRTKMSFTTAMKRLGGDIVDMGSVESSSVKKGESLADT
3518|gene|nph       DPDAVAEKHSDKLLGLLFFEPSTRTKMSFDTAMKRLGGDTVDMGSVDSSSVKKGESLADT
                    :* .   .: . :*.* ********.*** :: ****   :.** *: **:.***:*:**

1879|gene|hwa       VRVIAGYADAIVLRHPSEGAAKLAAEFVDIPVINAGDGAGQHPTQTLLDLYTMRENVGLD
6309|gene|nrc1      VRVIEGYADALVLRHPNQGAAQMASEFVDVPLLNAGDGAGHHPTQTLLDLYTIRENAGLE
1285|gene|hla       VRVIEGYADALVLRHPSEGAATLAAERVSVPVVNAGDGAGQHPSQTLLDLHTIRENHGLD
17830|gene|hbo      VRVVEGYGDAIVLRHPLEGAAKMASEFVDVPVINAGDGAGQHPTQTLLDLYTIRENAGLD
520|gene|hut        VRVVEGYADALVLRHPMEGSAKMASEFVDVPLINGGDGAGQHPTQTLLDLYTIRENAGLD
11225|gene|hma      VRVVEGYTDALVLRHPMEGSAKMASEFVDVPLVNAGDGAGQHPTQTLLDLYTIRENAGFD
1819|gene|hhi       VRVVEGYTDALVLRHPMEGSAKMASEFVDVPLVNAGDGAGQHPTQTLLDLYTIRENAGFE
3518|gene|nph       VRVIEGYTDAIVLRHPSEGSPKLASEFVDVPVINAGDGAGQHPTQTLLDMYTIRENAGLD
                    ***: ** **:***** :*:. :*:* *.:*::*.*****:**:*****::*:*** *::

1879|gene|hwa       EITVGIAGDLKYGRTVHSLAAALSNFDVRQHFISPESLQLPRNIRYDL-HDSGSQVREHT
6309|gene|nrc1      DLTIGIMGDLKYGRTVHSLSRALTNFDVDQHFISPESLQLPRDVVYDLEQESGTRVREHD
1285|gene|hla       DLTVGIMGDLKYGRTVHSLAAALTEFDANQHFISPESLRLPRSVRFDL-HETGAQVREHT
17830|gene|hbo      DLTIGIMGDLKYGRTVHSLAEALTNFDARQHFISPESLRLPRNVRYDL-HGSGAQVREHT
520|gene|hut        DLSIGIMGDLKYGRTVHSLAHALTNFDASQHFISPESLRLPRNVRYDL-HEEGATIREHT
11225|gene|hma      DLTIGIMGDLKYGRTVHSLAHALTTVDASQHFISPESLQLPRSVRYDL-HEAGAGIREHT
1819|gene|hhi       DLTIGIMGDLKYGRTVHSLAHALTTVDARQHFISPESLQLPRSVRYDL-HEAGAGIREHT
3518|gene|nph       DLTIGIMGDLKYGRTVHSLAHALTNFDVSQHFISPESLQLPRSVRYDL-HESGAQVREHT
                    ::::** ************: **: .*. *********.***.: :** :  *: :*** 

1879|gene|hwa       DIESILPELDVLYVTRIQRERFPDENEYQRVAGQYRVDTDILSHADNNLTVMHPLPRVDE
6309|gene|nrc1      SFEDVLPELDILYVTRIQRERFPDENEYQKVAGEYQLTATHLEAAKDDLTIMHPLPRVDE
1285|gene|hla       DLEGVLGELDVLYVTRIQKERFPDENEYHRVAGEYQIDAETLEDAPDDLTVMHPLPRVDE
17830|gene|hbo      ELSEVLPELDVLYVTRIQRERFPDENEYRKVAGQYQIDADDLSDAKDSLTVMHPLPRVDE
520|gene|hut        ALDTVLDSLDVLYVTRIQEERFPEESEYRKVAGEYRIDAETLESTRDDLTVLHPLPRVDE
11225|gene|hma      ELDDILPELDVLYVTRIQAERFPDESEYREVAGQYQIDGDTLAAAKDDLTVMHPLPRVDE
1819|gene|hhi       DLDEILPDLDVLYVTRIQAERFPDESEYREVAGQYQIDADTLDAAKDDLTVMHPLPRVDE
3518|gene|nph       DIESVLETLDVLYVTRIQRERFPDENEYRQVAGEYRIDADLLESAKDDLTVMHPLPRVSE
                     :. :*  **:******* ****:*.**. ***:*.:    *  : :.**::******.*

1879|gene|hwa       IAPEVDTTEHAAYFEQAHNGVPVRMALLDALI----GRAK-----
6309|gene|nrc1      IAPEIDDTDHAAYFEQAHNGVPVRMALLDLVL----SADGGVDDE
1285|gene|hla       IAPDVDETDHATYFEQAHNGIPVRMALLDILLENAEGDEGMEVDR
17830|gene|hbo      IAPEVDETAHAKYFEQAHNAVPVRMALLDMLL----EDN------
520|gene|hut        IDHDVDATSHAQYFQQAHNGVPVRMALLDLVL----GGESA----
11225|gene|hma      IAHDVDETTHAQYFQQAHNGVPVRMALLDLML----GGDQ-----
1819|gene|hhi       IAHDVDETTHAQYFQQAHNGVPVRMALLDLML----GGDQ-----
3518|gene|nph       IAADVDETEHATYFKQAHNGVPVRMALLDEML-------------
                    *  ::* * ** **:****.:******** ::