HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0514COG0008KOG1147 KOG1148 KOG1149arCOG04302Glutamyl- and glutaminyl-tRNA synthetasesglutamyl-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0514 nrc1 VNG1153 gltS glutamyl-tRNA synthetase
cHOG0514 hmu HMUK2609 Hmuk_2609 glutamyl-tRNA synthetase( EC:6.1.1.17 )
cHOG0514 hma RRNAC0085 gltX glutamyl-tRNA synthetase
cHOG0514 hwa HQ2888A gltX glutamyl-tRNA synthetase
cHOG0514 hla HLAC2322 Hlac_2322 glutamyl-tRNA synthetase
cHOG0514 hbo HBOR11940 Hbor_11940 glutamyl-tRNA synthetase( EC:6.1.1.17 )
cHOG0514 hut HUTA2071 Huta_2071 glutamyl-tRNA synthetase
cHOG0514 hvo HVO_2726 HVO_2726 gltX glutamyl-tRNA synthetase
cHOG0514 nph NP3694A gltX glutamyl-tRNA synthetase
cHOG0514 hhi 840 gltX glutamyl-tRNA synthetase
cHOG0514 hhi 4432 HAH_4432 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4432|hp|hhi         ---------------------------------------------------------MRV
1153|gene|nrc1      --MDDELRERVRRAAERAALFNALKHGSDAQVGAIMGPMMGEHPDFRAHGDEIPGVIAPV
3694|gene|nph       --MDEDLRERIEREAETAALFNALKHESDAQVGAILGPMMGENPDFRPHGDEIPGIISPV
2071|gene|hut       --MDEDLRERVEAAAEADALFNALKHDSDAQVGAIMGPLMGENPEFREYGDEIPGVLAPV
10085|gene|hma      --MDDELRDRITEAAETNALLNAVKHDSEAQVGAIMGPLMGENPEFREYGDEIPGVIAPV
840|gene|hhi        --MDDELRDRITEAAETNALLNAVKHDSEAQVGAIMGPLMGENPEFREYGDEIPGVIAPV
2322|gene|hla       --MDDELRERVEAASEAAALFNALKHGNDPDVGAIMGPLMGENPDFRPHGDEIPGIVAPV
2888|gene|hwa       MTIDDELRDRIKRSAKKHALLNAVKHKSDAEVGAIMGPLMGENPEFRPHGDAIPGIVSGV
11940|gene|hbo      --MDDDLRERVEREAEKHALLNAVKYESDADVGAVMGPLMGENPDFRPHGDEIPGVVGGV
                                                                               *

4432|hp|hhi         LDR--------------------------------------------QPYSYVLL-----
1153|gene|nrc1      IEDVNGMSDDEQRARLAELAPEDVEELDSEDEGDDHALPALPNA---EAYDEVRMRCAPN
3694|gene|nph       IERVNGLSDEEKRERLEELAPEKVEALAAEDEGDDRPLPELPNA---DAYDDVRMRLAPN
2071|gene|hut       VERVNGLSTEEKRERLAELAPERVEELDADEDEDEQALPDLPNV---EDYDEVRMRVAPN
10085|gene|hma      VERVNGMDAEERRERLAELAPEKLEELEAEDEGEDHPLPDLPSA---EEYDTVRMRVAPN
840|gene|hhi        VERVNGMDAEERRERLAELAPDKLEELESEDEGEDHPLPDLPNA---DEYDTVRMRVAPN
2322|gene|hla       VNRIAGMDEAERRDRLGELAPDKLAELEAEDEEDDHVLPDLPNA---ED-GEVVMRAAPN
2888|gene|hwa       VSQINDLSVDERRSRLETIAPEALTDIESEDTTDTYDLPSLPGVSDDEPTQSVRMRAAPN
11940|gene|hbo      VARVNDLPTEKKRDRLEELAPEELAEMEAEAEADDQILPDLPNV---EEYDEVRMRAAPN
                    :                                              :    * :     

4432|hp|hhi         ---------AR------------DGEWILTF-----------------------LLG---
1153|gene|nrc1      PNGPWHVGHARMPSVIGTYKQRYDGSFVVRFDDTDPETKRPDLDAYDQILEDLSYLGFEA
3694|gene|nph       PNGPWHVGHARMPAVIGTYKDRYDGWFCVRFDDTDPETKRPDLDAYGEILDAIDYLGFEP
2071|gene|hut       PNGPWHVGHARMAAVVGSYKDRYDGYFVCRFDDTDPETKRPDLDAYDEILDAIEYLGFTP
10085|gene|hma      PNGPWHIGHARMAAVVGTYKQRYDGEFICRFDDTDPETKRPDLDAYDAILDAIDYLGFEP
840|gene|hhi        PNGPWHIGHARMAAVVGTYKERYDGEFICRFDDTDPETKRPDLDAYDAILDAIDYLGFEP
2322|gene|hla       PNGPWHVGHARMPAVIGTYKERYDGKFICRFDDTDPETKRPDMDAYDAILEDIAYLGFEA
2888|gene|hwa       PNGPWHIGHARMPAVIGTYSNRYDGSFIIRFDDTDPETKRPDLDAYDDILEDVAYLGFEP
11940|gene|hbo      PNGPWHIGHARMPAVIGTYKDLYDGSFIVRFDDTDPETKRPDLDAYDAILEDVEYLGFEP
                             **            ** :   *                        **   

4432|hp|hhi         ------------------------GPV--------------------ERDVSVRLTPAEV
1153|gene|nrc1      DEVLTASDRVETYYEHARRLIGMGGAYTCSCPGAEFSDLKNSGEACPHRDKDPETVADEF
3694|gene|nph       DEVVKASDRVETYYEYGRKLIKAGGAYTCSCDAESFSELKNNAEACPHRDKDIETTLSEF
2071|gene|hut       NRVLKASDRLETYYAYARDLIDLGGAYTCSCPGETFSELKNSGEACPHREKDAATVHEEF
10085|gene|hma      DDVVNASDRVETYYEYARKLIDKGGAYTCSCPQGEFSDLKNNGEACPHRDKDAETTRSEF
840|gene|hhi        DDVVNASDRVETYYEYARELIDRGGAYTCSCPQGEFSDLKNSGEACPHREKDAETTRSEF
2322|gene|hla       DRVLKASDRLETYYDHARDLIDAGGAYTCSCSGDDFSALKNDAEACPHRDKDTETVHEEF
2888|gene|hwa       DDVIRASDRLELYYARARELIDAGGAYTCSCSGEHFSKLKNAGEACPHREKSVNQTQTEF
11940|gene|hbo      DEVLRASDRVETYYDHAREIIEMGKAYTCSCSGEDFSELKNAGEPCPHRDKDPETTREEF
                                             .                      *: .   .  *.

4432|hp|hhi         TAIEDGESSATDLVETVRTDLSA-------------------------------------
1153|gene|nrc1      EAMVDGEYNSGEMVLRVKTDITHKNPALRDWVAFRMVDTPHPRDAASGYRCWPMLDFQSG
3694|gene|nph       EAMIDGEYSAGEMVLRVRTDIEHKNPALRDWVAFRMVDTPHPREEAADYRCWPMLDFQSG
2071|gene|hut       DAMVDGEYDPGEMVLRVKTDIEHKNPALRDWVAFRLIDTPHPRPEAEDYRCWPMLDFQSG
10085|gene|hma      EAMVDGEYDSGEMVLRVRTDITHKNPALRDFVAFRMVDTPHPREAAEQYRCWPMLDFQSG
840|gene|hhi        EAMVDGEYDSGEMVLRVRTDITHKNPALRDFVAFRMVDTPHPRAAAEEYRCWPMLDFQSG
2322|gene|hla       SAMVDGEYSAGEMVLRVRTDIEHKNPALRDWVAFRMIDTPHPREEAADYRCWPMLDFQSG
2888|gene|hwa       EAMIHGEYSAGEMVLRVRTDIEHKNPALRDWVAFRLIDTPHPRPQAADYRCWPMLDFQSG
11940|gene|hbo      EAMIDGEYSSGEMVLRIKTDIEHKNPALRDWVAFRMVDTPHPREEAADYRCWPMLDFQSG
                     *:  ** .. ::*  :.**:                                       

4432|hp|hhi         ------------------------------------------------------------
1153|gene|nrc1      VDDHRTGVTHIIRGIDLQDSAKRQRFLYEYFGWEYPEVVHWGHVQLDAYDVAMSTSTIKE
3694|gene|nph       IDDHEFGISHIIRGIDLQDSAKRQQFVYEYFDWEYPEVIHWGHVQIDAYDIEMSTSTIKQ
2071|gene|hut       IDDHLTGITHIIRGIDLQDSAKRQGFVYDYFDWEYPEVIHWGHVQVEEYDVPMSTSTIKE
10085|gene|hma      LDDHLLGVTHIIRGIDLQDSAKRQQFVYDYFDWEYPEVIHWGHVQVDEYDVPLSTSSIAE
840|gene|hhi        LDDHLLGVTHIIRGIDLQDSAKRQQFVYDYFDWEYPEVIHWGHVQVDEYDVPLSTSSIAE
2322|gene|hla       VDDHLTGVTHIIRGIDLQDSAKRQRFVYDYFDWEYPEVLHWGHVQVDEYDVKLSTSTIKE
2888|gene|hwa       IDDHETGVTHIIRGIDLQDSAKRQRFVYDYFDWEYPEVVHWGHINVDEYDVSLSTSTLIE
11940|gene|hbo      VDDHLTGVTHIIRGIDLQDSAKRQGFLYDYFGWEYPEVVHWGHVQVDAYDVKMSTSTLKE
                                                                                

4432|hp|hhi         ---------YDDRRIRPTV-----------------------------------------
1153|gene|nrc1      RIAAGELEGWDDPRA-PTMQSIRRRGIRGAAVVDAMVELGTSSSDVELAMSAVYANNRDL
3694|gene|nph       LIDDGELDDWDDPRA-PTVASLKRRGIRGQAIVNAMVELGTSTSNVDLAMSSVYAENREF
2071|gene|hut       LIEAGDLEGWDDPRA-PTIASLRRRGIRGGAIVDAMTELGTSTSNVDLAMSSIYAANRER
10085|gene|hma      LIEDGELAGWDDPRA-PTVASLERRGIRGEAVVDAMIQLGTSTSNVDLAMSSIYSNNRDL
840|gene|hhi        LIADGELAGWDDPRA-PTVASLERRGIRGEAVVDAMIQLGTSTSNVDLAMSSIYSNNRDL
2322|gene|hla       LIETGELTGWDDPRA-PTIQSMRRRGIQGQALVDSMTALGMSTSDVDLAMSSVYANNRDL
2888|gene|hwa       KIETGELDGWDDPRA-PTLQSLRRRGIKGDAIVEAMINLGTSTTNVELSMSSIYSNNRQH
11940|gene|hbo      KIEAGELDGWDDPRA-PTLKSLRRRGIRGSAIVDAMLELGTSTSDVDLSMSAIYSNNRDI
                             :** *  **:                                         

4432|hp|hhi         ------------------------------------------------------------
1153|gene|nrc1      VDDTAPRQFLVRDGFEARGEGPEESHEAVEVPVDDG----PDEATPQVHPEHPDRGDREI
3694|gene|nph       VDDEADRRFFVRDG--------------VEKPLAGG----PESASPPLHPNDEDRGRREI
2071|gene|hut       IDDDADRAFFVRDG--------------VEMDLSGG----PERGQPPIHPDYEERGKRTI
10085|gene|hma      IDDDSDRAFFVRDS--------DDHGGLVERQIVGG----PDAGEPPLHPDYEERGRREI
840|gene|hhi        IDDDSDRAFFVRDS--------DDHGGLVERQVVGG----PDAGEPPLHPDFEERGRREI
2322|gene|hla       VDDEANRYFFVRDR---------DDDPAVELPVVDGDASAPETGHPPLHPDYPDRGEREV
2888|gene|hwa       IDAKADRYFFVRNG----------ETFTLETASED-----TIAGHPPLHPDNPERGERVV
11940|gene|hbo      VDDEADRYFLVRDG--------------ERFAVEGG----PDAGHPALHPDHEDRGDRTV
                                                                                

4432|hp|hhi         --------------------W---------------------------------------
1153|gene|nrc1      PVGERVLVEATDLPAAGDRVWLKGYGPVRYDGER-FAFLDADIDIVREEGVDVVQWVPAE
3694|gene|nph       PVGDAVYVEPDDVPADGERVWLKGLGPVRHEDGA-FVATDDDIEVVRDGAVDVVHWVPAQ
2071|gene|hut       PVGGAVLVEEEDLPPEGDRVWLKGYGCVRRTGERAFEYTDDDIDVVREGNVDVIHWVPAT
10085|gene|hma      PVTSGVVVEGDDLPDHGDRIWLKGYGCVRHTRDA-FEYTGDDIDAVREEGVDVIHWAPAD
840|gene|hhi        PVTSGVVVEGDDLPDHGARIWLKGYGCVRHTRDA-FEYTGDDIDAVREEGVDVIHWAPAD
2322|gene|hla       PAG-RIAVESSDLPSEGERVWLKGYGCVRYEGDE-LTFVGASIDVVRDGDVDVIHWAPAD
2888|gene|hwa       PVTDGITIEPADVPADGDRVWLKGYACVRRDDNH-FRTTNDGIEVVREGDVDVIHWAPAP
11940|gene|hbo      PATDGVRIESADVPASGERVWLKGYGCVRREDDA-LVHTDDTIEAVRSGDVDVIHWAPAE
                                        *                                       

4432|hp|hhi         ----------------------PGKTDDE-------------------------------
1153|gene|nrc1      H---NVDVRLRTMDGDVTGYAEPGFADRDADEIVQFVRVGFARVDAHRD-----------
3694|gene|nph       E---SVPLRLRTVDGDEAGHAEPGIETYDADDIVQFERIGFARIDRHD------------
2071|gene|hut       T---SVPARLRTMEGDVTGHVEPGLLTHGADEMVQFVRIGFARLDAVPEASDPMDVGE--
10085|gene|hma      ----GPALRLRTMDGDVSGVAEPGLRNYDTDDVVQFERIGFARLDKVADDS---------
840|gene|hhi        ----GPQVRLRTMDGDVSGVAEPGLRHYDADEVVQFERIGFARLDEVADDP---------
2322|gene|hla       E---GLDTLLRTVSGDVRGIAEPAVAEVDPDTVVQFVRVGFARIDAFDPEATDEPDGPTG
2888|gene|hwa       ESSASISVRMRTPDGDITGIAEPDLTDAEIDDIVQFERVGFARIDTKDEQSL--------
11940|gene|hbo      D---NVAVRMRTMEGDVTGVAEPDFADTETDDVVQFERIGFVRVDSHDSDARDA------
                                          *                                     

4432|hp|hhi         -----------
1153|gene|nrc1      GGASVAYFTHP
3694|gene|nph       DEESVAYFAHP
2071|gene|hut       DDELLAYFAHP
10085|gene|hma      DTESVAYFTHP
840|gene|hhi        DTESVAYFTHP
2322|gene|hla       EEDLLAYYAHP
2888|gene|hwa       DTDMTVYWTHP
11940|gene|hbo      DDESVVYWSHK