HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0513COG1235arCOG00499Metal-dependent hydrolases of the beta-lactamase superfamily IATP-binding protein

HOG Organism Gene ID Name Annotation
cHOG0513 nrc1 VNG2060 phnP ATP-binding protein
cHOG0513 hmu HMUK0734 Hmuk_0734 beta-lactamase domain protein
cHOG0513 hma RRNAC2820 phnP ATP-binding protein PhnP
cHOG0513 hwa HQ3105A phnP PhnP-like protein
cHOG0513 hla HLAC2544 Hlac_2544 PhnP-like protein
cHOG0513 hbo HBOR05110 Hbor_05110 metal-dependent hydrolase, beta-lactamase superfamily I
cHOG0513 hut HUTA2213 Huta_2213 beta-lactamase domain protein
cHOG0513 hvo HVO_1905 HVO_1905 phnP ATP-binding protein
cHOG0513 nph NP2250A phnP PhnP-like protein
cHOG0513 hhi 101 phnP ATP-binding protein PhnP
MUSCLE (3.6) multiple sequence alignment


2213|gene|hut       MEVTLLGTGDTTGTPTVGCGCDVCEQARDPDDALREQLRDRGVEVGDRGVERTRFSVHVR
12820|gene|hma      MEVTLLGTGDTTGTPTVQCDCDTCERARDPDEELRANVRERGIDPTG-GVERSRFSVAVE
101|gene|hhi        MEVTLLGTGDTTGTPTVQCDCDTCERARDPDEELRARVRERGIDPTG-GVERSRFSVAVA
2250|gene|nph       MEVTLLGTGDTTGTPTPSCKCETCQRARER------------------GVERSRFSVHVH
2060|gene|nrc1      MKVTLLGTGDTTGTPTPGCDCATCQAARER------------------GVERTRFSVHVA
3105|gene|hwa       MLVTLLGTGDTTGTPTVGCDCNTCEHARQR------------------GIERTRFSVHIE
2544|gene|hla       MRVTLLGTGDTTGTPTVGCDCDTCAAARER------------------GVSRSRFSVHVA
5110|gene|hbo       MRVTLLGTGDTTGTPTVGCECDTCREARAR------------------GVERTRFSVHVE
                    * **************  * * .*  **                    *:.*:**** : 

2213|gene|hut       NERTDETLLIDASPDFRTQFLRED-LDAPDAAVISHVHFDHLDGLGNFYRLTRDMPVYAA
12820|gene|hma      NDTTGESLLVDLSPDFRHQFLRES-VPLPDAAIITHIHFDHLDGLGNAYRLFDELPVHAA
101|gene|hhi        NDETGESLLIDLSPDFRHQFLREG-VPLPDAAIVTHVHFDHLDGLGNAYRLFDELPVHAA
2250|gene|nph       NDRTGESLLVDASPDFRSQFLSND-VDLPDAIVISHIHFDHLDGLGNAYRLLEDVPVFAA
2060|gene|nrc1      DEASGDALLIDFSPDFRAQFLRTDALSLPDAGVVTHVHFDHLDGLGNAYRLFDDLPVYAA
3105|gene|hwa       NPRRNESILIDFSPDFRQQFLQRN-VSFPDAGIITHIHFDHLDGLGNAYRLCDDLPIHAA
2544|gene|hla       NERTGESLLVDFSPDFRSQFLDND-VPLPDAGIVTHIHFDHLDGLGNVYRLVDGLPVHAP
5110|gene|hbo       NDRTGESLLIDFSPDFRQQFLTHE-VPLPDAGLITHVHFDHIDGLGNAYRVFDDLPVHAA
                    :   .:::*:* ***** ***    :  *** :::*:****:***** **:   :*:.*.

2213|gene|hut       GEVDPATGQSVAQSVRERYDYL-DVIDVKARDPFESFRVAGLDVTLVPVDHPPLSCYGLV
12820|gene|hma      DETDPVTDESVAEAVRSRYDYL-DTVSVHAQTPLEPFTVAGFEVTLVPVTHPPLLCYGLR
101|gene|hhi        DETDPVTGESVAEGVRSRYDYL-DTVSVHAQTPFEPFIVAGFEVTLVPVTHPPLLCYGLR
2250|gene|nph       DEVDPATGESVAETVGDKYDYL-DAITVEPRSPFEPFETCGFEVTLVPVEHPPLVCYGLH
2060|gene|nrc1      TDTDPTTGESVAETVAGKYDYL-DSIALRGVAPRRSFAAAGFDVTLVPVDHPPLLCYGVV
3105|gene|hwa       NETDPQTTETVAETVARKYSYL-DQVTVNPHSPFEVFEICGLEIQLVPVDHPPLYCYGVV
2544|gene|hla       SETDPATDESVAETIRSKYDYLEDRIGVHSRDPFDPFESCGFEVRFVPVDHPPLLCYGVV
5110|gene|hbo       DETDPKTGQSVAETVASKFDYL-DRISVRAQTPFETFRTCGLDVTLVPVEHPPLLCYGLT
                     :.** * ::**: :  .:.** * : :    *   *  .*::: :*** **** ***: 

2213|gene|hut       VEDPETGAKLSLSGDTSYEVPQASRDALAGADLLLVDGILPADRCDTHPAGGSHHDDEGV
12820|gene|hma      IEEPQTGAVLSISGDTCYDVPDRSKSVLTGADLALVEGIVHPEACEYHPKGGTHHNEDGV
101|gene|hhi        IEEPQTGAVLSISGDTCYDVPDRSKSVLTGADLALVEGIVHPEACEYHPKGGTHHDEDGV
2250|gene|nph       IEDPETGATLALSGDSNYAIDDASRDVLRNPDLFFADGIVPAAYCEYHPAGGDHADADGT
2060|gene|nrc1      VE--RAGAKLAVSGDTTYAIPEASRDAMRDPDLLVADGIVPAHLTHHHPKGGRHPDADGV
3105|gene|hwa       IEDPVTDTKLSLSGDTSYGVPSESQDALSNPDLFLADAIVPASMCEHHPLGGKHHNKDGV
2544|gene|hla       IEDPETGAKLSLTGDTSYDVPERSRDALADADLLLADAIVPASLCDHHPIGGRHEGPDGV
5110|gene|hbo       IEDSETGAKLSLSGDTSYGIPEDSRSVLSDPDLLLAEAIVPASLCQHHPLGGKHFDDEGV
                    :*   :.: *:::**: * : . *...: ..** ..:.*: .     ** ** * . :*.

2213|gene|hut       PMTYGSKHMTIEGAQRLSEELDAGELRIVHLSHYLPVETAFDVPLAVDGERFVL
12820|gene|hma      PRTFGTKHMTLPGARDFAADIEADDYRIVHTAHYVPADRAFADDIGLDGEQFML
101|gene|hhi        PRTFGTKHMTLPGARDFAADIEADDYRIVHTAHYVPADRAFADDIGLDGERFTL
2250|gene|nph       YRTFGTKHMTVEGARRLADDLDADDYRLVHLSHYIPADEAFDDDMAVDGERFEL
2060|gene|nrc1      PRTFGTKHMTREGALALGDDLDADRTRVVHAAHYYPVEEAFADEIAVDGETIRL
3105|gene|hwa       PRTFGTKHMTREGACDLAEALDADKTRFVHTGHYYPADEAFEDPLAIDGEEYRL
2544|gene|hla       PRTFGSKHMTREGALALADELDADRTRLVHLAHFYPPDEAFEEPLAVDGEVYEL
5110|gene|hbo       PRTFGTKHMTREGALALADDLNAEQTRLVHTAHYYPVEEAFEEPLAVDGEVYKL
                      *:*:****  **  :.  ::*   *.** .*: * : **   :.:***   *