HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0510COG1813KOG3398arCOG01863Predicted transcription factor homolog of eukaryotic MBF1transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0510 nrc1 VNG1029 mbf1 transcriptional regulator
cHOG0510 hmu HMUK2372 Hmuk_2372 transcriptional regulator, XRE family
cHOG0510 hma RRNAC0535 HTH DNA-binding protein
cHOG0510 hwa HQ3361A transcriptional regulator
cHOG0510 hla HLAC0686 Hlac_686 transcriptional regulator, XRE family
cHOG0510 hbo HBOR19270 Hbor_19270 transcriptional regulator, XRE family
cHOG0510 hut HUTA0360 Huta_0360 transcriptional regulator, XRE family
cHOG0510 hvo HVO_1299 HVO_1299 HTH DNA-binding protein
cHOG0510 nph NP2146A hypothetical protein
cHOG0510 hhi 1108 HAH_1108 XRE family transcriptional regulator/HTH DNA-binding protein
MUSCLE (3.6) multiple sequence alignment


686|gene|hla        MPQCEMCGADEASLTTTKVEGAELELCSSCTDFGTEVRDESTG-SGGSKYSTSSSSGTSS
3361|gene|hwa       MPQCEMCGSDQSSLTTVKVEGAELELCGDCKEFGTEVRTESSS-STSTKYSTSSSNSDES
19270|gene|hbo      -----MCGKERPSLTTVKVEGAELELCDDCSEFGTEVRTESSSASGSTKYSTSSSSGSSS
1029|chp|nrc1       MAQCEMCGTEVSSPKTVKVEGAEIDVCDDCAEFGTEVTTQSSS-STSTKYSTSSSSSQSA
360|gene|hut        MVQCEMCGAETAAPNTVKVEGAELDVCDECADFGTEVRTQESS-SASTKYSTDSSGSSSS
2146|hp|nph         MVQCEMCGAETGSPKTVKIEGAELDVCDDCADFGTEVQTQDTS-STSTKYSTSSSGSSSS
10535|gene|hma      MVQCEMCGTEVSSPNRVKIEGAELDVCDECTDFGTEVKTEETS-STSTKYSTSSSSSSSS
1108|gene|hhi       -----MCGTEVSSPNRVKIEGAELDVCDECTDFGTEVKTEETS-STSTKYSTSSSSSSSS
                         *** :  : . .*:****:::*..* :*****  :.:. * .:****.**.. .:

686|gene|hla        ---GSSSGSSGGSSGSSGGSTRPRDMFDNMDEIATDYDDRIRNARESRGLSQEELADQLN
3361|gene|hwa       ---STNSTGSTTSSASQSGGSPRRDMFDNMDEIAADYDNRIRQARESRSLSQEDLADSLN
19270|gene|hbo      -SSSSASSGSSSSSSSGGSTRRRRDMFDDMDEIAADYDDRIRQARENNGMSQEDLADSLN
1029|chp|nrc1       -------GSSGGSSGTNSGGRRRRDMFDEMDELAGDYDTRIRSAREQAGLSQEELADELN
360|gene|hut        --SSSGSASGGGGSGGSSGGGSRRDMFDEMDELVQDFDQRIRSAREAADMSQEELADQLN
2146|hp|nph         GGSSGSSTSSSTGSGGGGGGGSRRDMFDEMDEVVQDYDDRIREAREAASMTQEELANSLN
10535|gene|hma      ------SSSSSSSSTGGGSSGRRRDMFDEMDEVAQDYDDRIRKGRESQGLSQEELAKQLN
1108|gene|hhi       -----SSSSSSSSSGGGGSGGRRRDMFDEMDEIAQDYHDRIRKGRESQGLSQEELAKQLN
                            ..  .*   ..    *****:***:. *:  ***..**  .::**:**..**

686|gene|hla        EKASLIRKLERGDTLPTDDIQRKLESELDITLV-EGESAD--DADWDSG-DAGTMTLGDV
3361|gene|hwa       EKASLIRKLERSDILPSDDVREKLERRLDISLV-EGTDTD--EDEWSGGSST-TTTLGDV
19270|gene|hbo      EKASLIRKLERGDILPPDNVRKKLERKLDISLV-EGGDEE--ESEWSGGSST-TTTLGDV
1029|chp|nrc1       EKASVIRKLEHGDSLPSDDVREELEDYLGILLT-ESGAEDASDTDWSSGGDSAGLTLGDK
360|gene|hut        EKASLIRKLEHGDHLPSDDVQQKLERALDIELTESGGTDD--DADWDSGSAVGEYTLGDV
2146|hp|nph         EKASLIRKLERGEVLPSDSVQRKLERELDISLS-TGGGSD--DNDWSGGSSTGKTTLGDV
10535|gene|hma      EKASLIRKLEQGNSLPSDDVQKKLESALEISLS-AGGSAD--ETEWSGGSSDGEYTLGDV
1108|gene|hhi       EKASLIRKLEQGNSLPSDDVQKKLESALEISLS-AGGSAD--ETEWSGGSSDGEYTLGDV
                    ****:*****..: **.*.:. :**  * * *   .   :  : :*..*      **** 

686|gene|hla        VKRK--D-
3361|gene|hwa       VKRK--D-
19270|gene|hbo      VKRK--D-
1029|chp|nrc1       VRRKSDDS
360|gene|hut        VERK--DS
2146|hp|nph         VKRK--D-
10535|gene|hma      VKRK--D-
1108|gene|hhi       VKRK--D-
                    * **  *