HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0051COG0251KOG2317arCOG01630Putative translation initiation inhibitor yjgF familyhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0051 nrc1 VNG2099 vng2099 no entry
cHOG0051 hmu HMUK0835 Hmuk_0835 endoribonuclease L-PSP
cHOG0051 hma PNG7235b ern1 endoribonuclease L-PSP
cHOG0051 hma PNG7321b ern2 endoribonuclease L-PSP
cHOG0051 hwa HQ1769A psp ribonuclease, PSP-type
cHOG0051 hla HLAC0419 Hlac_419 endoribonuclease L-PSP
cHOG0051 hbo HBOR27350 Hbor_27350 endoribonuclease L-PSP
cHOG0051 hbo HBOR37940b Hbor_37940 phage integrase family protein
cHOG0051 hbo HBOR39910b Hbor_39910 endoribonuclease L-PSP
cHOG0051 hut HUTA1777 Huta_1777 endoribonuclease L-PSP
cHOG0051 hvo HVO_0459 HVO_0459 endoribonuclease L-PSP putative
cHOG0051 nph NP0566A psp1 ribonuclease, PSP-type
cHOG0051 hhi 5320 tdcF2 endoribonuclease L-PSP
cHOG0051 hhi 5231 tdcF1 endoribonuclease L-PSP
MUSCLE (3.6) multiple sequence alignment


37940|gene|hbo      MVEEKTLTDYNGRPLADASQPLDQEQLAAWREAALEADGVKRLAGLLSPYTGLRNSTVAH
7321|gene|hma       ------------------------------------------------------------
5231|gene|hhi       ------------------------------------------------------------
1769|gene|hwa       ------------------------------------------------------------
566|gene|nph        ------------------------------------------------------------
39910|gene|hbo      ------------------------------------------------------------
2099|chp|nrc1       ------------------------------------------------------------
1777|gene|hut       ------------------------------------------------------------
419|gene|hla        ------------------------------------------------------------
27350|gene|hbo      ------------------------------------------------------------
7235|gene|hma       ------------------------------------------------------------
5320|gene|hhi       ------------------------------------------------------------
                                                                                

37940|gene|hbo      LRPSWVVYKTKIPEIVVPSEAPCNLGNGDDACYRCQVNRDGTWKPESPHGARRVPVPDED
7321|gene|hma       --MRWGQVRPDMKRVVSTDEAPAAVGAYSQATSNGDLLITAGQLPLTTDG----------
5231|gene|hhi       -----------MKRVISTDEAPAAVGAYSQATSNGDLLITAGQLPLTTDG----------
1769|gene|hwa       -----------MKETVETDNAPAAVGAYSQAATNGEILITAGQLPMTSDG----------
566|gene|nph        ----------MSKEIVSTDEAPAAAGAYSQATTDGNLIFTAGQIAMTPDG----------
39910|gene|hbo      ------------MRPIKTREAPAAVGAYSQATTNGNLLFTSGQIPMTPDG----------
2099|chp|nrc1       -----------MKRPIETADAPAAVGAYSQAATDGDVVFTAGQIPMTPDG----------
1777|gene|hut       -----------MKRTIETDAAPAAVGAYSQATATDELVFTAGQIPLTPDG----------
419|gene|hla        -----------MKETVHTDAAPAAVGAYSQATTNGDLVFTAGQIPLTPDG----------
27350|gene|hbo      -----------MKRTISTDDAPAAVGAYSQATTNGSVLFTAGQIPLTPDG----------
7235|gene|hma       -----------MKRTISTADAPDAVGAYSQATTNGSLVFTAGQIPMTPDG----------
5320|gene|hhi       -----------MKRTISTADAPDAVGAYSQATTNGSLVFTAGQIPMTPDG----------
                                   : .  **   *  .:*    .:   . . . :. *          

37940|gene|hbo      VVEALRDYFALYDKLRTEQRLRTYLKDLVKDASLQRDVNAHALRHTYGTILARKGFEIET
7321|gene|hma       --------------------------ELLDDEPV--ADQTRQCLHNVAAILESEDLSLDD
5231|gene|hhi       --------------------------ELLDGEPV--ADQTRQCLHNVAAILESEDLSLDD
1769|gene|hwa       --------------------------ELLDEASV--ARQTTQCLENIVAVLESEELRPTD
566|gene|nph        --------------------------DSLADEPI--EVQTERALKNLEAVLEAAGAGLDD
39910|gene|hbo      --------------------------ELLSDASV--AEQTVQVLDNVASILDSEGLTMGD
2099|chp|nrc1       --------------------------ELIADEPI--DVQTRQSLENVKAILEAEGLNMQD
1777|gene|hut       --------------------------DLLDDAAI--DVQTQQALDNVAAVLDEAGASMDD
419|gene|hla        --------------------------DLLDDASI--AEQTEQALDNLVAVLDEAGADPAD
27350|gene|hbo      --------------------------ELLDDEDI--ATQTKQSLDNVMAILESEGADASD
7235|gene|hma       --------------------------DLLDDKPI--ATQAEQALSNVEAVLASEGLEMSD
5320|gene|hhi       --------------------------DLLDDEPI--ATQAEQALSNVEAVIASEGLEMSD
                                              : :    :    ::     .  :::         

37940|gene|hbo      MRQAMGYSMDEDNGRFAVRRYIQFVDEREEERYACGADRAQGGTCEMPVDTPDARCYVHD
7321|gene|hma       VLKTTVYLDDIDDFDSFNEAYSEFFESEPPARSAVGVGAVPKG-----------------
5231|gene|hhi       VLKTTVYLDDIDDFDSFNEAYSEFFESEPPARSAVGVGAVPKG-----------------
1769|gene|hwa       ILKTTVFLDDIEDFDSFNKAYSSFFDSDPPARSAVGVEAVPKG-----------------
566|gene|nph        VLKTTVYLADIDDFEAMNGTYADFFDGEPPARSAVEAGDLPLG-----------------
39910|gene|hbo      VLKMTVYLGDIENFDEMNEQYSEYFEDAPPARSAVEVANLPKG-----------------
2099|chp|nrc1       VLKVSVFMDDMDDFDAMNAAYKEYFQDNPPARSAVEVAALPKG-----------------
1777|gene|hut       VLKVTVYVEDIEDFEAMDAAYETFFDEEPPARSAVEVAALPKG-----------------
419|gene|hla        VLKTTVFLADIDDFDEMNETYAGYFEESPPARSAVQAGALPKG-----------------
27350|gene|hbo      VLKVSVFLDDIEDFDEMNETYADYFDEEPPARSALEVANLPKG-----------------
7235|gene|hma       VLKVTVYLDDIDDFEDMNDTYAGFFDEAPPARSAVEVANLPKG-----------------
5320|gene|hhi       VLKVTVYLDDIDDFESMNDTYAGFFDDEPPARSAVEVASLPKD-----------------
                    : :   :  * ::       *  :.:     * *  .     .                 

37940|gene|hbo      DRVITCSATNRYGEPCHRIVDQLTQRCAFHQD
7321|gene|hma       -------------------AAVEIEAIATTE-
5231|gene|hhi       -------------------AAVEIEAIATTE-
1769|gene|hwa       -------------------AAVEIEAIVTVE-
566|gene|nph        -------------------MGVEIEAVATKP-
39910|gene|hbo      -------------------VDIEIEAIATL--
2099|chp|nrc1       -------------------VGVEIEAIAAQRD
1777|gene|hut       -------------------VGVEIEAVATV--
419|gene|hla        -------------------VGVEIEAVAVAE-
27350|gene|hbo      -------------------VGVEIEAIADIE-
7235|gene|hma       -------------------VGVEIEAIATND-
5320|gene|hhi       -------------------VGVEIEAIATSE-
                                            :  .