HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0509COG2317arCOG04247Zn-dependent carboxypeptidaseprobable carboxypeptidase

HOG Organism Gene ID Name Annotation
cHOG0509 nrc1 VNG2616 cxp probable carboxypeptidase
cHOG0509 hmu HMUK0281 Hmuk_0281 Carboxypeptidase Taq( EC:3.4.17.19 )
cHOG0509 hma RRNAC2092 cxp carboxypeptidase
cHOG0509 hwa HQ1367A cxp carboxypeptidase
cHOG0509 hla HLAC1280 Hlac_1280 peptidase M32 carboxypeptidase Taq metallopeptidase
cHOG0509 hbo HBOR27750 Hbor_27750 carboxypeptidase Taq( EC:3.4.17.19 )
cHOG0509 hut HUTA0152 Huta_0152 Carboxypeptidase Taq
cHOG0509 hvo HVO_0417 HVO_0417 cxp metal-dependent carboxypeptidase
cHOG0509 nph NP0944A cxp_1 carboxypeptidase
cHOG0509 hhi 2585 HAH_2585 carboxypeptidase
MUSCLE (3.6) multiple sequence alignment


1367|gene|hwa       -------MIHHQSTSGGLIALPWYILIMSTDAYATLCEQYEQIANIQHAQSVLSWDQQVT
1280|gene|hla       --------MATEAAADDAADAP--------EAYDALLDRVRRWNAVGSAAGVLGWDQQVM
27750|gene|hbo      MRDVFRFDMATETAGADAESAP--------DAYTELLQTYKRVANVRNAGGLLSWDQQVM
944|gene|nph        ------MTNPDSAGSDADASTP--------TAYDDLLERYRRATYLSDANGVLSWDQEVM
2616|gene|nrc1      --------------MAHATQSP--------DAYDALLDHYETITGLGGAAGILSWDQEVM
152|gene|hut        ----------------MGAKAP--------DAYAELLDHVQQLSYVADAGGLLRWDQQVM
12092|gene|hma      -------------MATASEDSE--------STYEQFLDHVRRLHYVGDAGGVLNWDQQVM
2585|gene|hhi       -------------MATASEDSE--------STYEQFLDHVRRLHYVEDAGGVLNWDQQVM
                                                   :*  : :       :  * .:* ***:* 

1367|gene|hwa       MPEGGTPARTAQLSALSTVAHNALTDDIIADALETLRANSDSLSSDEKATVREIRRKHER
1280|gene|hla       MPEGGTPARSKQLSTLSSIRHDMVTDEETGDLLDEL--ADADLTDERAAVVREIRRDYER
27750|gene|hbo      MPEGGTPARSQQLSTLSAVAHDLLTDEAVGEKLDEL--EDADLTDEQAAVVREIRRQYDR
944|gene|nph        MPEGGTPARSKQRGAVSAVAHDVLVDEETADALDAL--DGVDLTDDEAAVVREIRREHER
2616|gene|nrc1      MPEGGTPARSTQKSAVSTVRHDLLTDQQVADWLDDL--ADADLTDEQAAVVREIRREHER
152|gene|hut        MPDGGTPARSKQQSALSTLHHDLLTDDDLADSLAEL--EAVDLEPEQQAVVREVSREHER
12092|gene|hma      MPDAGTPARAKQTSAISTLHHELLTDDALADWLDEL--DDAELDPEQEAVVREVRRDHER
2585|gene|hhi       MPDAGTPARAKQTSAISTLHHDLLTDDDLADWLDEL--DDADLDPEQEAVVREVRRDHER
                    **:.*****: * .::*:: *: :.*:  .: *  *     .*  :  *.***: *.::*

1367|gene|hwa       AAAVPESLVAEMSETASEALSVWESAKANNDFNAFAPYLQRHVELNREYAEYIDPTRDAY
1280|gene|hla       ADAVPVELVEEISETGTEALQAWEEAKAEDDFDAFAPYLEKHVELKREYAEHIDPDRDPY
27750|gene|hbo      AVSVPSELVEEISTTSSEALPAWEEAKAEDDFSVFAPYLEKHIELKREYAEHIDPDKDPY
944|gene|nph        KARVPTELVEEISTATSEAHPVWNEAKAADDFDAFAPTLAELLDLKRRYAEHIDPDADPY
2616|gene|nrc1      AARVPSDLIADLSEKTSEAHPKWKQAREEDDFSIFAPVLEDLIDLKREYANHIDPDADAY
152|gene|hut        ARNVPRDLVERISETTSEALPVWEQARADDDFESFAPVLEELVELRREYAEAIDPDRDPY
12092|gene|hma      ATRVPADLVERISEASSNALPVWKEAKAEDDFDAFADTLEELVELRREYAAAIDPDRDPY
2585|gene|hhi       ATRVPADLVERLSEASSNALPVWKEAKAEDDFDAFADTLEELVELRREYAAAIDPDRDPY
                       ** .*:  :*   ::*   *:.*.  :**. **  *   ::*.* **  ***  *.*

1367|gene|hwa       AVLLEEFEPCLPLDHVESVLREIREALIPMIDAIRASDTTLATDAFTRQGT-YSSANQEA
1280|gene|hla       EVLFEDYEPCLSMERAESILEELRETLVPMIDAIRESDADLAVDTF--EGT-FPEAEQEA
27750|gene|hbo      EVLFEEFEPCLPLEQAEEILSELRDTLVPMIEQIREEGDDIATDAFTSKGD-YSEDGQEE
944|gene|nph        ATLFAEYEPYLDLSTAERVLEELRDGLVPLIDAIGASDTEL--YAL--EGT-FPEDDQFA
2616|gene|nrc1      EVLFADYEPYLDLDTAERVLERLRDELVPLIADIRDSDVTLA-DPF--AGSQFDVDTQED
152|gene|hut        EVLFEEFEPYLGLDTAERILERLRDELVPLIDDVADSGVTQP-LPF--EGT-FDVDDQEA
12092|gene|hma      EVLFEEYEPYLGIDTAEDVLTDLRDALVPLIDDIGDSDVTLA-DPF--EGT-YDDDTQHD
2585|gene|hhi       EVLFEEYEPYLGIDTAEEVLTNLRDALVPLIDDIADSDVTLA-DPF--EGI-YDDDTQHD
                     .*: ::** * :. .* :*  :*: *:*:*  :  ..      .:   *  :    *  

1367|gene|hwa       LCRDVLTTLGYPWERGRLDTAPHPFSMGTSFDARVTTRFDETDPLGSLFSTIHEFGHATY
1280|gene|hla       LARETLELVGYDFDRGRLDVSSHPFTAGNQFDCRVTTRFDESDPLGAIGSTIHEFGHAQY
27750|gene|hbo      LCRDVLSTLGYPWERGRMDTSSHPFSSGTMFDARVTTRFDETDPLGSLFSTVHEFGHATY
944|gene|nph        VTEAALETLGYDFEHGRLDTAPHPFSTGTQFDARVTTRFDESEPLDSLASTIHEFGHATY
2616|gene|nrc1      LARDVLDTLGYDWEHGRIDTAPHPFSSGTPFDARVTTRFDPEKPVDALLSTIHEFGHARY
152|gene|hut        LVREALDELGFDWNRGRLDTSAHPFTSGTQFDARITTRFDEEKPLDSLSSTIHEFGHATY
12092|gene|hma      LVETALDVLGYDWDRGRLDTAPHPFSMGTQFDARVTTRFTPEDPLDALGSTIHEFGHATY
2585|gene|hhi       LVETALDTLGYDWDRGRLDTAPHPFSMGTQFDARVTTRFTPEDPLDALGSTIHEFGHATY
                    :   .*  :*: ::.**:*.:.***: *. **.*:****   .*:.:: **:****** *

1367|gene|hwa       TLGLSDDAYATPLGEDRDLSVHESQSRLWENHVGRSRAFWNVLLPQINTHFPKTDALSVN
1280|gene|hla       NLGLPQEQFGTPLGESRDLSVHESQSRLWENHVGRSRAFWELFLPTFQEHFPETDDATVE
27750|gene|hbo      NLGLPDEHYATPLGEDRNLSVHESQSRLWENHVGRSEAFWNVLLPTFKEHFQKAEDVTLQ
944|gene|nph        TLGLPRDAYGSPLGEHRGLSVHESQSRLFENHVGRSKPFWELFVDRFNDHHDT--ELTPQ
2616|gene|nrc1      TLGLPRAEYGTPLGESRDLTVHESQSRLWENHIGRSPAFWEAFLPEMKTQFPQVEDATPQ
152|gene|hut        SLGLPDDHYGTPLGESRDLTVHESQSRLWENHIGRSQAFWEYFMPTVEDHLGV--GASAE
12092|gene|hma      TLGLPQEDYGTPLGDNRDLSVHESQSRFWENHVGRSRPFWDFFTETANDHLGT--DATAQ
2585|gene|hhi       TLGLPQEAYGTPLGDNRDLSVHESQSRFWENHVGRSRSFWDFFTETANDHLGT--DATAQ
                    .***.   :.:***: *.*:*******::***:*** .**: :    : :       : :

1367|gene|hwa       EAYEAANQVYKDNLIRVNADELTYHLHVLIRYEIERALIAGDIDVAEVPAIWDDKYEEYL
1280|gene|hla       DAYQAFNQVHEDNLIRVEADELTYHLHIVVRFEIERDLVRGDLAIEDVPEAWNDKYEEYL
27750|gene|hbo      EAYEAANQVYDDNLIRVESDELTYHLHIIIRFEIERALIAGDIDVEDVPEVWNDKYEEYL
944|gene|nph        QAYEAANRVYDDNLIRVEADELTYHLHIVLRFEIERELLAGDLDVEEVPAAWNDRMESYL
2616|gene|nrc1      AAFEAANEIFEDNLIRVEADELTYHMHIVVRFEIERELIEGDLDVADVPEAWNDKYEEYL
152|gene|hut        DAYRSVNRVYDDNLIRVEADELTYHMHIVLRFEIERALIGGDLDVSEVPHVWNDKMEEYL
12092|gene|hma      QFYEASNEVYDDNLIRVEADELTYHMHIIVRFEIERDLIRGDLDVEDVPEVWNDKMEEYL
2585|gene|hhi       QFYEAFNEVYDDNLIRVEADELTYHMHIIVRFEIERDLIRGDLAVEDVPGVWNDKMEEYL
                      : : * :..******::******:*:::*:**** *: **: : :**  *:*. *.**

1367|gene|hwa       GIRPETDAEGCLQDIHWSHGNIGYFPTYSLGSAMAAQLYAAAEESIVELDSKVAAGSFDE
1280|gene|hla       GIRPDNDAEGCLQDIHWSHGNFGYFPTYSLGSVMAAQLFAAAESEIDDLDDQIAAGEFDD
27750|gene|hbo      GIRPETDSEGCLQDIHWSHGNFGYFPTYSLGSVMAAQLYAAAEEDIDDLAGHIEAGDFEP
944|gene|nph        GVRPETDAEGCLQDIHWSHGSFGYFPTYSLGSVLAAQLYAAADEAIDGLESQIAAGEFDA
2616|gene|nrc1      GVRPETDAEGCLQDIHWSQGSIGYFPTYSLGSVLAAQIFAALEADIGPVDERVREGDFDV
152|gene|hut        GVRPDTDAEGCLQDIHWTNGTFGYFPTYSLGSVLAAQLYDAADAEIGPFDDTVRAGEFDA
12092|gene|hma      GIRPDTDAEGCLQDIHWTNGAFGYFPTYTLGSVLAAQLDHHARQDIDGFDDHVRAGEFGP
2585|gene|hhi       GIRPDTDAEGCLQDIHWTNGAFGYFPTYTLGSVLAAQLDHHARQDIDGFDDHVRAGEFGP
                    *:**:.*:*********::* :******:***.:***:       *  .   :  *.*  

1367|gene|hwa       IRRWLQTNVHQHGARYETDKLITQATGSSFTADAFISYVSEKYGSLYDLDQEFRVGN
1280|gene|hla       LREWLGENVHQHGSRYETNELVKRATGEDFSADAFTDYVEEKYGELYGI--------
27750|gene|hbo      LHEWLTENVHQHGARYETNELVVQATDEDFTADAFIDYVTEKYGDLYGIDA------
944|gene|nph        LHEWLTENIHQHGRRYTTGDVIERATGEPLTADYFLEYAEAKFGELYDL--------
2616|gene|nrc1      VGDWLESNVHQHGARYTTPDLVREATGEAFTADYFLDHVHEKYGELYDL--------
152|gene|hut        LHEWLTENVHQHGKRYPTEDLIEEATGETYTADYFLEYVTEKYGSLYDL--------
12092|gene|hma      IHDWLTEHVHQHGARYRTDDLVEEATGESFTAEHFLDYADEKYRALYDC--------
2585|gene|hhi       IHDWLTENVHQHGARYRTDDLVEEATGESFTAEHFLDYAEEKYRALYDC--------
                    :  **  ::**** ** * .::  **..  :*: * .:.  *:  **.