HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0508COG1910 COG0303arCOG00217molybdenum cofactor biosynthesis protein

HOG Organism Gene ID Name Annotation
cHOG0508 nrc1 VNG0086 moeA2 molybdenum cofactor biosynthesis protein
cHOG0508 hmu HMUK2502 Hmuk_2502 molybdenum cofactor synthesis domain protein
cHOG0508 hma RRNAC1299 moeA3 molybdopterin biosynthesis protein moeA
cHOG0508 hwa HQ3344A moeA molybdenum cofactor biosynthesis protein MoeA
cHOG0508 hla HLAC2123 Hlac_2123 molybdenum cofactor synthesis domain protein
cHOG0508 hbo HBOR07200 Hbor_07200 molybdopterin molybdochelatase
cHOG0508 hut HUTA0036 Huta_0036 molybdenum cofactor synthesis domain protein
cHOG0508 hvo HVO_2305 HVO_2305 moeA molybdopterin biosynthesis protein moeA
cHOG0508 nph NP1442A moeA_2 molybdenum cofactor biosynthesis protein MoeA
cHOG0508 hhi 1891 moeA2 molybdopterin biosynthesis protein moeA
MUSCLE (3.6) multiple sequence alignment


36|gene|hut         ---MTDRREFRDLASGEELAATIDSLELEAGTERASLENARGRVLAERITAEIDVPGFDR
3344|gene|hwa       ---MTDRREFRDLVSPDVAHEIIHDLPIASPPETVSLTSARGRVLAERIDADIDVPGFDR
86|gene|nrc1        --VSDDRREFRDLASPARAREVLAALDVTPAPETVPLAEARGRVLAERVDATIDVPGFDR
11299|gene|hma      ------------------------------------------------------------
1891|gene|hhi       MVPMSDRREFRDLASPEEAHEVVADLDIDPAPETVPLADARDRVLAERVDADIDVPGFDR
1442|gene|nph       ----MSRKQFRDLADPETARETIASLDLAPEPTEVPLREARGRVLASRIDAELDVPGFDR
2123|gene|hla       ---MSDRKEFRDLATPEAAREAIDDLDLSPAPETVPLEDARGRVLAERIDAAIDVPGFDR
7200|gene|hbo       -MVGVSRKEFRDLAAPEAAHEAIAGLDLTPETERVPLRESRGRVLAERIDAEMDVPGFDR
                                                                                

36|gene|hut         AAMDGYAVKAGDTVDAGEASPVDLETVGTLHAGENPTESIEAGEAIEISTGAVLPPGADA
3344|gene|hwa       ASMDGYAVRGRDTFGADEAAPVDLDRIGAVHAGATPDITVDSGEAAEISTGAVMPPGADA
86|gene|nrc1        ASMDGYAVRAADTFGASEADPARLSVAGTVHAGEEPAVEVTAGRAVVVSTGAVMPPGADA
11299|gene|hma      --MDGYAVHARDTFGADEADPVTLSVVGEVHAGEEPDVTVEPGSLAEISTGAVMPAGADA
1891|gene|hhi       ASMDGYAVHARDTFGADEADPVTLSVAGEVHAGEEPDVTVESGSVAEISTGAVMPPGADA
1442|gene|nph       ASVDGYAVRAADTFGADEADPAELELAGAVHAGVEPSVEVAIGECVEVSTGAVVPPGADA
2123|gene|hla       ASMDGYAVRARDTFGADEADPADLDLVGAVHAGAAPEVTVEPGTCAEISTGAVMPDGADA
7200|gene|hbo       ASMDGYAVRARDTFGADEASPAELELIGEVHAGVEPDVVVGEGEAAEISTGAVMPDGADA
                      :*****.. **..*.** *. *.  * :***  *   :  *    :*****:* ****

36|gene|hut         VVVVEATSERDGS----------VAIRDAVTPGENVMPAGADVAAGRRVLGPKTRLTPRE
3344|gene|hwa       VVIVERTQEHDDG--------ATVRVHDAVAPGDNVMIAGTDVAAGTRALGPGTRLTPRE
86|gene|nrc1        VVKVEATTEADGG--------DAVDVRTSVAPGTAVMLAGADIAAGSRAIGPGTKLTARE
11299|gene|hma      VVMVERTTETDDG----------IEIRTSVAPGDNVMLAGADIAAGARALGPGTRITPRE
1891|gene|hhi       VVMVERTTETDDG----------VEIRTSVAPGDNVMLAGADIAAGARALGPGTRITPRE
1442|gene|nph       VVMVERTDEDAGV----------VSVRTALAPGDGVMFAGADVAAGERALGPGTVLTPRE
2123|gene|hla       VVMVERTDEVGGDPDAEGGGPDRIAVRTAVAPGDHVMSAGADIAAGARALGPGTRLTPRE
7200|gene|hbo       VVIVERTEERDGT----------LVVRDAVAPGDSVMLAGADVAAGARALGPGTYLTPRE
                    ** ** * *  .           : :. :::**  ** **:*:*** *.:** * :*.**

36|gene|hut         IGLLSAIGCDAVTVRKPPTVGIISTGDELVRPDDTLDSAPGQIHDVNSYTIAAAVEEAGG
3344|gene|hwa       IGLLSALGVESVPVRGRPTVGIVSTGDELVRPGSTLDTTRGQIYDVNSYTIAAGVEEAGG
86|gene|nrc1        IGVLSALGVGSVRVRGAPTVGIISTGDELVRPGDPLDSAAGQIHDVNSHTIAAAVEAAGG
11299|gene|hma      IGLLSALGVDEVPVRGRPQVGILSTGDELVRPGNPLDSAAGQIYDVNSYTLAGAVAEAGG
1891|gene|hhi       IGLLSALGLDEVPVRGRPKVGILSTGDELVRPGDPLDSAAGQIYDVNSYTLAGAVSEAGG
1442|gene|nph       IGLLSALGVDSVPVRGQPTVGIISTGDELVRPGGDLDSSAGEIYDVNSYTIATAVEAAGG
2123|gene|hla       IGLLSALGVDEVPVAGKPRVGIVSTGDELVRPGEALDPSRGEIYDVNSTTIAAGVEEAGG
7200|gene|hbo       IGLLSALGVDEVPVRGKPTVGIISTGDELVRPGDPLNSDAGQIYDVNSYTIATGVEEAGG
                    **:***:*   * *   * ***:*********.  *:.  *:*:**** *:* .*  ***

36|gene|hut         RSRVYPHVGDDEGSIANTLTQAANECDLVLSSGSTSASTMDVIYRVIEQRGELLLHGTAV
3344|gene|hwa       EAKLYPHTGDDYDEMEQLLIEAADECDLVLSSGSTSASAVDVIYRVIESRGDLRLHGVAV
86|gene|nrc1        EPVVYPHAGDDYAEMERLLVESAADCDLVLSSGSTSASAVDVIYRVAEERGDLLLHGVAV
11299|gene|hma      DPVMYPHAGDDYEEMERLLHEAANECDLVLSSGSTSASAVDVIYRVIEERGELRLHGVAV
1891|gene|hhi       DPVMYPHAGDDYAEMERLLHEAADECDLVLSSGSTSASAVDVIYRVIEERGELRLHGVAV
1442|gene|nph       EARLYPHAGDDYEAMESVLREAADDCDLVLSSGSTSASAVDVIYRVIEDTGELLLHGVAV
2123|gene|hla       EPVLYPHAGDDYTEMERLLRRAADECDLVLSSGSTSASAVDVIYRVIEERGDLLLHGVAV
7200|gene|hbo       EVRMYPHAGDDYEEMERILVQAAEECDLVLSSGSTSASAVDVIYRVIEERGELLLHGVAV
                       :***.***   :   *  :* :*************::****** *. *:* ***.**

36|gene|hut         KPGKPTIVGQF---------------------EDAAYIGLPGYPVSALTIFRVFVAPAIR
3344|gene|hwa       KPGKPMLVGEL---------------------DGSAYIGLPGYPVSALTIFRLFVAPAIR
86|gene|nrc1        KPGKPMLVGEI---------------------EGTAYVGLPGYPVSALTIFRVFVAPVVR
11299|gene|hma      KPGKPMLVGTI---------------------GDSAYVGLPGYPVSALTIFQTFVAPAVR
1891|gene|hhi       KPGKPMLVGTI---------------------GDSAYVGLPGYPVSALTIFQTFVAPAVR
1442|gene|nph       KPGKPMLVGRI---------------------ADSAYIGLPGYPVSALTIFRTFVAPAVR
2123|gene|hla       KPGKPMLIGRLDRGGSEAVGESDADGDTDPRTGESAYVGLPGYPVSALTIFRTFVAPAIR
7200|gene|hbo       KPGKPMLVGTL---GGERGAKSENKGDTAATDSPSAYVGLPGYPVSALTIFQTFVAPAIR
                    ***** ::* :                       :**:*************. ****.:*

36|gene|hut         AAAGLPERRTATVEADMATRARFEEGRRRFLPVALVEDGDGRT-LAYPVDKGSGATTTLV
3344|gene|hwa       SVAGQPNPQTATLTGKMAVEERYAEGRLRLMPVGTVSNTVGET-LVYPVDKGSGATTSLV
86|gene|nrc1        EAAGRGQPEPTVVTGEMARQERSAEGRRRLLPVGLVEDGAGDR-LVYPVDKGSGATTSLV
11299|gene|hma      DAAGRDPPRTATVSGTMAVQERYGEGRRRLMPAGLVEDETGSL-LVYPVDKGSGATTSLV
1891|gene|hhi       DAAGRDPPQTATVSGTMAVQERYGEGRRRLMPAGLVEDETGSL-LVYPVDKGSGATTSLV
1442|gene|nph       EAAGLPEPETATVSGEMAVRERYSEGRQRYMPAGLVADGDGTT-LVYPVDKGSGATTSLV
2123|gene|hla       EAAGQPEPATATIEGRMAVGERYGEGRMRLMPVGLLDLNDGDLPLVYPVDKGSGATTSLV
7200|gene|hbo       RAAGLPNPQTATVSGSMAVRERYAEGRLRLMPVGLLENESGET-LVYPVDKGSGATTSLV
                     .**     .:.: . **   *  *** * :*.. :    *   *.***********:**

36|gene|hut         DADGVVDVDAQTAYLDPDESVTVELFSADAAIPSLLGAGEGDSHLWDLLDQLDRPRYLAE
3344|gene|hwa       EADGVVAVDPDTEYLATGESVTVELFSPDVRPPTLLGVGEDDPVFSRILDTLSNPRYLAI
86|gene|nrc1        DADGTVTVPADTAYVAAGDSVDVALFAPDARAPRVLAVGEDDPLFSRVLDDVARPRFLPV
11299|gene|hma      DADGFVDVPPGTDYLAEGEAVDVTLFSPAVRPPTLLGMGEDDPLLSRLLDTIGRPRYLPL
1891|gene|hhi       DADGFVDVPPGTDYLAEGEAVDVTLFSPAVRPPTLLGMGEDDPLLSRLLDTVSRPRYLPL
1442|gene|nph       EADGVVSVPPDVEYLDAGERVTVHLFSPDVRPPALFGAGEDDPALSRLLDRVDRPRHLGV
2123|gene|hla       EADGVVAVDPDTEYLDRDERVTVQLFSPDVRPPTLLGVGEDDPALNRLLDRLDAPRYLPV
7200|gene|hbo       EADGVVEVHPDTEYLADGESVEVRLFSPDVRAPTLLGVGEDDPALSRLLDRLDSPRYLPV
                    :*** * * . . *:  .: * * **:. .  * ::. **.*. :  :** :  **.*  

36|gene|hut         GSRTGVRLLEDGVTDVAVIAGPIEAPAESVVLDSWEREWGLAVPTGNPDDVTGLDDLIDG
3344|gene|hwa       GSREGRRRLRNDVPDIAVVAGPSDRSLDTISLGSWKREWGLLVPTGNPANIDELSDIIEM
86|gene|nrc1        GTREGLRRLREGVPDVVVVAGPATPDGDAVSLGGWTREWGIVVPAGNPAGVDSVADLVDR
11299|gene|hma      GSTEGLRRLDNGVPDVAVVAGPAADDHDAADIGGWEREWGLVV--GPDTDVSDLGDLVDG
1891|gene|hhi       GSTEGLRRLDNGVPDIAVVAGPTSSDHEATDIGGWQREWGLVV--SPDTDVSDLGDLVDG
1442|gene|nph       GSRQGRRRLRDGVTDIAVVTGDADIDG-AVTLGGWRRQWGLVVPAGNPDDVSDLSDLVDR
2123|gene|hla       GSREGLRRLRDGVPDVAVVAGPTDRDVDAVDLGGWAREWGLVVPEGNPAGVTGLADLVDG
7200|gene|hbo       GSREGLRRLRDGVPDVAVVAGPTERTVESVDIGGWTREWGLIVPAGNPDDVSGLSDLVAR
                    *:  * * * :.*.*:.*::*       :  :..* *:**: *  .   .:  : *::  

36|gene|hut         DLLVATVDSQWGLAGSFDAAIDELANSRDEAQATLQRSLRTIE--TRSFESPARRVVAGD
3344|gene|hwa       NQQFVNRRTDSGLRRELDATIDSLADDRNVSREKLTQSIQGYERGAKGVESPARAIIQGN
86|gene|nrc1        DLGLVNRARGSGLRRCFDDAIAALAAERPASRRALTDAIDGYELTTTAHESPARKVAAGD
11299|gene|hma      DYRFVNRDTASGLRRSFDDALDALGEDRGVGRAEVVDAIEGYELTTKAHESPARKVMAGG
1891|gene|hhi       DYRFVNRDSASGLRRSFDDAVDALGEERGVGRAELIDAIDGYELTTKAHESPARKVLASD
1442|gene|nph       ELRFVNRTTDSGLRGTLETALESLAADRDRDVAGLFSDIDGFGLAVRAHESPARKVRSGD
2123|gene|hla       EMRFVNRPTDSGLRRSLDDALADLATDRDASRGDLADRIDGYELTVRAFESPVRKVLAGD
7200|gene|hbo       DLRFVNRDTNAGLRASLDAALDELAAERDTSKRELTARIDGFELTTKATESPARAVLRGK
                    :  ...     **   :: ::  *. .*      :   :      . . ***.* :  . 

36|gene|hut         ADAGVTLAETAADLDVTFVSLGTERVEIVAAADRLEKAGVRTLRDRLASE----------
3344|gene|hwa       ADTGLGLRITATERDLEFISLGTQQVSVEANPNRIEKSGVEELSDHLDSDTVNIDSYHGY
86|gene|nrc1        ADAGLGLAATAASLDLGFVPLGTQSVTVVAAPDRVDKPGVRDLAAALDDCGGLAAPLEGI
11299|gene|hma      ADAGLGLHATAAKLDLGFVSLGTQQVRVLANPDRREKHSVGALEEALDDLDSLADGIAGM
1891|gene|hhi       ADAGLGLRATAAKLDLGFVSLGTESVRVLVNPDRREKDSIGSLAEVLSDLGALTDGMAGM
1442|gene|nph       ADAGLGLRATAEKLGLGFVPCGTEQVQVLADASRTGKDGVEAFRQALDDLPAVAGSLPGY
2123|gene|hla       ADAGLGLRETADRLDCGFVSLGEQSVTVRAAPDRVERDAVEELADALNDPTDLLADLAGY
7200|gene|hbo       ADAGLGLRATANELDMGFIRVGDESVRVHANPDRTEKPSVEAITALLSDADDVFDELSGY
                    **:*: *  **   .  *:  * : * : . ..*  . .:  :   * .           

36|gene|hut         --------
3344|gene|hwa       EH------
86|gene|nrc1        DPQ-----
11299|gene|hma      EPQ-----
1891|gene|hhi       EPQ-----
1442|gene|nph       DS------
2123|gene|hla       SRNSRNDP
7200|gene|hbo       NR------