HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0507COG0085KOG0216 KOG0214 KOG0215arCOG01762DNA-directed RNA polymerase beta subunit/140 kD subunitDNA-directed RNA polymerase subunit B'

HOG Organism Gene ID Name Annotation
cHOG0507 nrc1 VNG2665 rpoB' DNA-directed RNA polymerase subunit B'
cHOG0507 hmu HMUK0514 Hmuk_0514 RNA polymerase Rpb2 domain 6( EC:2.7.7.6 )
cHOG0507 hma RRNAC2429 rpoB DNA-directed RNA polymerase subunit B'
cHOG0507 hwa HQ3395A rpoB1 DNA-directed RNA polymerase subunit B'
cHOG0507 hla HLAC0106 Hlac_106 RNA polymerase Rpb2 domain 6
cHOG0507 hbo HBOR28230 Hbor_28230 DNA-directed RNA polymerase, subunit B'( EC:2.7.7.6 )
cHOG0507 hut HUTA0783 Huta_0783 RNA polymerase Rpb2 domain 6
cHOG0507 hvo HVO_0348 HVO_0348 rpoB DNA-directed RNA polymerase beta subunit
cHOG0507 nph NP0112A rpoB1 DNA-directed RNA polymerase subunit B'
cHOG0507 hhi 2861 rpoB' DNA-directed RNA polymerase subunit B'
MUSCLE (3.6) multiple sequence alignment


106|gene|hla        MAQA--EREAKVYVNGSLVGTHPDPEALAEQIREARRRGDVSEMVNVSVKDRTQEVIVNA
3395|gene|hwa       MAQTPKQREAKVYVNGSLVGTHESPETLADNIREARRRGEVSDMVNVSVKERTREVIINA
28230|gene|hbo      MAQT-QQREAKVYVNGSLVGTHPDPKQLAEQIREARRRGDVSQMVNVSVKERTREVIINA
348|gene|hvo        MAQA--QREAKVYVNGSLVGTHPDPNQLAAQIREARRRGDVSQMVNVSVKERTREVIINA
2665|gene|nrc1      MSTE---REAKVYVNGSLVGTHENPEELAEQIREARRRGEVSEMVNVSVRDRTGEVIVNA
112|gene|nph        MSQG-QGRDAKVYVNGSLIGTHPDPHKLANDIREARRRGEVDEMVNVSVRDRTDEVIVNA
783|gene|hut        MSQG---RDAKVYVNGSLVGTHPEPNQLADQVRRARRRGEISEMVNVSVKPRTGEVIINA
12429|gene|hma      MSQG---REAKVYVNGSLVGTHPDPEQLAEQVRQARRRGDVSQMVNVSVKNRTGEVIINA
2861|gene|hhi       -------------------------------------------MVNVSVKNRTGEVIINA
                                                               ******. ** ***:**

106|gene|hla        DAGRARRPLIVVENGEPLLGDEEIEALERGDVEFEDLVERGYVEFIDAEEEEDILVAVDE
3395|gene|hwa       DAGRARRPLIVVEDGNPRLGDNEIDAVKSGDLSFEDLVNRGYIEFIDAEEEEDIYVAVDE
28230|gene|hbo      DAGRARRPLIVVEDGEPLLSDDEIAAVKNDEIDFEDLIDRGYIEFIDAEEEEDIYVAVDE
348|gene|hvo        DAGRARRPLIVVEDGEPLLDDDHVEALDNDELDFDDLVERGLVEFIDAEEEEDIYVAVDE
2665|gene|nrc1      DAGRARRPLLVVENGEPVVTQEEVEAVKNGDIDFEDLVEAGKVEFIDAEEEEDILVGVEE
112|gene|nph        DAGRARRPLIVVEDGEPLLGDAEIEALEDGELEFEDLVDRGYVEFIDAEEEEDIYVAVDE
783|gene|hut        DAGRARRPLLVVEDGEPLISEEEYAAIENGELTFEELVERGFVEFIDAEEEEDILVAVDT
12429|gene|hma      DAGRARRPLLVVEDGEPLMTDEEVEQVKEGELEFEELVERGLVEFIDAEEEEDILVGVDE
2861|gene|hhi       DAGRARRPLLVVEDGEPLMTDEEVEQVKEGELEFEELVERGLVEFIDAEEEEDILVGVDE
                    *********:***:*:* : :     :. .:: *::*:: * :*********** *.*: 

106|gene|hla        EDVTDDHTHLEIDPQLVFGIGAGMIPYPEHNASPRITMGAGMMKQSLGLPSANYRIRPDT
3395|gene|hwa       DELEEAHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGMMKQSLGLPAANYRIRPDT
28230|gene|hbo      DDLNEDHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGMMKQSLGLPSANYRIRPDT
348|gene|hvo        DELNEDHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGMMKQSLGLPAANYRIRPDT
2665|gene|nrc1      EELTTDHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGMMKQSLGLPAANYRIRPDT
112|gene|nph        DDLSEDHTHLEVDPQLMFGIGAGMIPYPEHNASPRITMGSGMIKQSLGLPSANYRIRPDT
783|gene|hut        DELTENHTHLEVDPQLIFGIGAGMIPYPEHNASPRITMGSGMIKQSLGLPSANYRVRPDT
12429|gene|hma      GELTDNHTHLEVDPQLMFGIGAGMIPYPEHNASPRITMGSGMIKQSLGLPSANYRIRPDT
2861|gene|hhi       DELTEKHTHLEVDPQLMFGIGAGMIPYPEHNASPRITMGSGMIKQSLGLPSANYRIRPDT
                     ::   *****:****:**********************:**:*******:****:****

106|gene|hla        RQHLLHYPQLAMVKTQTSDQISFDKRPAAQNFVVAVMSYEGFNIEDALVMNQGSVDRALT
3395|gene|hwa       RQHLLHYPQLSMVKTQTTEQIGFDERPAAQNFVVAVMSYEGFNIEDALVMNQGSVDRAMA
28230|gene|hbo      RQHLLHYPQLSMVKTQTTEQIGFDERPAAQNFTVAVMSYEGFNIEDALVMNKGSVDRAMA
348|gene|hvo        RQHLMHYPQLSMVKTQTTEQIGFDERPAAQNFVVAVMSYEGFNIEDALVMNKGSVERALA
2665|gene|nrc1      RQHLLHYPQKAMVNTQTTEQIGYDDRPAGQNFVVAVMSYEGFNIEDALVMNKGSVERALS
112|gene|nph        RQHLLHYPQLSIVKTQTTEQIGYDDRPAAQNFVVAVMSYEGFNIEDALVMNKASIERALA
783|gene|hut        RQHLLHYPQLSMVKTQTTEQIGYDDRPAAQNFTVAVMSYEGFNIEDALVMNKGSVERALA
12429|gene|hma      RQHLLHYPQLSMVKTQTTEQIGYDDRPAAQNFVVAVMSYEGFNIEDALVMNQGSVDRALA
2861|gene|hhi       RQHLLHYPQLSMVKTQTTEQIGYDDRPAAQNFVVAVMSYEGFNIEDALVMNQGSVDRALA
                    ****:**** ::*:***::**.:*.***.***.******************:.*::**::

106|gene|hla        RSHFFRTYEGEERRYPGGQEDRFEIPDQDVRGARGEDAYTHLDEDGLVNPETKVDESSVL
3395|gene|hwa       RSHFFRTYEGEERRYPGGQEDRFEIPSQDVRGARGENAYTHLDEDGLVNPETRVDENSVL
28230|gene|hbo      RSHFFRTYEGEERRYPGGQEDRFEVPSQDVRGARGEDAYNHLDDDGLVNPETVVDENSVL
348|gene|hvo        RSHFFRTYEGEERRYPGGQEDRFEIPSQDVRGARGEDAYSHLDEDGLVNPETVVDENSVL
2665|gene|nrc1      RSHFFRTYEGEERRYPGGQEDRFEIPGDDVRGARGEDAYTHLDDDGLVNPETKVDDSSVL
112|gene|nph        RSHFFRTYEGEERRYPGGQEDHFEIPDDEVRGARGEEAYSHLDEDGLVNPETHVGENDVL
783|gene|hut        RSHFFRTYEGEERRYPGGQEDRFEIPDDEVRGARGEDAYTHLDEDGLVNPETKVGENAVL
12429|gene|hma      RSHFFRTYEGEERRYPGGQEDRFEIPDDEVRGARGEEAYTHLDDDGLVNPETKVGENAVL
2861|gene|hhi       RSHFFRTYEGEERRYPGGQEDRFEIPDDEVRGARGEEAYTHLDDDGLVNPETKVGENAVL
                    *********************.**:*.::*******:**.***:******** *.:. **

106|gene|hla        LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLSKVKVRD
3395|gene|hwa       LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLAKVSVRD
28230|gene|hbo      LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGENGVVDTVTLMEGEDGSKLAKVSVRD
348|gene|hvo        LGKTSPPRFLEEPDDMAGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLAKVSVRD
2665|gene|nrc1      LGKTSPPRFLEEPEDMGGLSPQKRRETSVTMRSGEDGVVDTVTLMEGEDGSKLAKVSVRD
112|gene|nph        LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGIVDTVTLMEGEDGSKLSKVKVRD
783|gene|hut        LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLSKVKVRD
12429|gene|hma      LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLSKVSVRD
2861|gene|hhi       LGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVTLMEGEDGSKLSKVSVRD
                    *************:**.******************.*:***************:**.***

106|gene|hla        QRVPELGDKFASRHGQKGVVGHLAPQEDMPFTEEGVVPDLVMNPHALPSRMTVGHVLEML
3395|gene|hwa       QRVPELGDKFASRHGQKGVVGHLAPQEDMPFTEEGVVPDLVLNPHALPSRMTVGHVLEML
28230|gene|hbo      QRIPELGDKFASRHGQKGVVGHLAPQEDMPFTADGVVPDLVINPHALPSRMTVGHVLEML
348|gene|hvo        QRVPELGDKFASRHGQKGVVGHLAPQEDMPFTADGVVPDLVLNPHALPSRMTVGHVLEML
2665|gene|nrc1      ERIPELGDKFASRHGQKGVVGHLAPQEDMPFTQEGVVPDLVLNPHALPSRMTVGHVLEML
112|gene|nph        ERVPELGDKFASRHGQKGVVGHLAPQEDMPFTQDGVVPDLILNPHALPSRMTVGHILEML
783|gene|hut        ERIPELGDKFASRHGQKGIVGHIAPQEDMPFTEQGVVPDLIINPHALPSRMTVGHILEMI
12429|gene|hma      ERIPELGDKFASRHGQKGVVGHIAPQEDMPFTEEGVVPDLIINPHALPSRMTVGHILEMI
2861|gene|hhi       ERIPELGDKFASRHGQKGVVGHIAPQEDMPFTEEGVVPDLIINPHALPSRMTVGHILEMI
                    :*:***************:***:********* :******::*************:***:

106|gene|hla        GGKVGSLRGSRVDGTPFQGEDEEELRGGLEEHGFKSSGKEVMYSGVTGEKIEAEIFVGTI
3395|gene|hwa       GGKVGSLQGRRVDGTAFQGEDEEDLREGLEEYGFNSSGKEVMYSGITGEKIDAEIFVGTI
28230|gene|hbo      GGKVGALEGRRVDGTAFQGEDESELRGALEEHGFKSSGKEVMYSGVTGEKIEAEIFVGII
348|gene|hvo        GGKVGALEGRRVDGTAFQGENEEELRSALEERGFMSSGKEVMYSGVTGEKIEAEIFVGII
2665|gene|nrc1      GGKAGSLDGRSVDGTPFTGEGEDEIRGTLEDRGFKSSGKEVMYSGVSGEKIEAEIFVGTI
112|gene|nph        GGKVGSLEGRRVDGTPFQGEDEDELRESLIDRGFKSNGKEVMYSGITGEKIEAEIFVGVI
783|gene|hut        GGKVGALEGRRVDGTAFTGEDEEDLRDSLEDHGFDSSGKEVMYSGITGEKVEAEIFVGNI
12429|gene|hma      GGKVGALEGRRVDGTAFTGEDEDELRGSLEEHGFDSSGKETMYSGVTGEKIDAEIFVGDI
2861|gene|hhi       GGKVGALEGRRVDGTAFTGEDEEELRGSLEDHGFDSSGKETMYSGVTGEKIDAEIFVGDI
                    ***.*:* *  ****.* **.*.::*  * : ** *.***.****::***::****** *

106|gene|hla        FYHKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRVGEMERDTIIGHGASMVLNER
3395|gene|hwa       FYHKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRLGEMERDTVIGHGAAMVLQER
28230|gene|hbo      FYHKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRLGEMERDTVIGHGAAMVLQER
348|gene|hvo        FYHKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRLGEMERDTVIGHGAAMVLQER
2665|gene|nrc1      FYHKLYHMVSNKLHARSKGPVQVLTRQPTEGRAREGGLRVGEMERDTVIGHGAAMVLKER
112|gene|nph        FYQKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRIGEMERDVFIGHGAAMTLKER
783|gene|hut        FYQKLYHMVSNKIHARSRGPVQVLTRQPTEGRAREGGLRIGEMERDVFIGHGAALTLKER
12429|gene|hma      FYQKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRVGEMERDVLIGHGAAMALKER
2861|gene|hhi       FYQKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRVGEMERDVLIGHGAAMALKER
                    **:*********:****.*********************:******..*****::.*:**

106|gene|hla        LLESSDAETVHVSAETGLVAVEDREQRRVYDPVTGDEDDIHELEVSYAFKLLLDEMIALG
3395|gene|hwa       LLDSSDKEEVYVSADTGMVAVEDRGQRRIYDPVTGDEDDIHEIEISYAFKLLLDEMIALG
28230|gene|hbo      LLDSSDKEEVYVSADTGMVAVEDRDQRRIYDPVTGDEDNIHEIEISYAFKLLLDEMIALG
348|gene|hvo        LLDSSDKEKVYISADTGMVAVEDRDQRRIYDPVTGDEDNIHEIEISYAFKLLLDEMVALG
2665|gene|nrc1      LLDSSDREEIHVCGNCGMTAVENYEQRRVYCPNCEEETDVHSIEMSYAFKLLLDEMKALG
112|gene|nph        LLDESDREDIYVCGQCGMSAVENVEQRRVYCPNCDEETDVHEVEMSYAFKLLLDEMKALG
783|gene|hut        LLDESDQEWIHVCGQCGMTAVENVDQRRVYCPNCDEETDVHEVEMSYAFKLLLDEMKALG
12429|gene|hma      LLDESDREWINVCGQCGMTAVENVEQRRIYCPNCEEETDIHEVEMSYAFKLLLDEMKALG
2861|gene|hhi       LLDESDREWINVCGQCGMTAVENVEQRRIYCPNCEEETDIHEVEMSYAFKLLLDEMKALG
                    **:.** * : :..: *: ***:  ***:* *   :* ::*.:*:*********** ***

106|gene|hla        IRPKLELEDAI
3395|gene|hwa       IRPRLDLQDAV
28230|gene|hbo      IRPRLNLEDAV
348|gene|hvo        VRPRIELKDAV
2665|gene|nrc1      IAPRLELEEAV
112|gene|nph        IAPRIELEDAV
783|gene|hut        IAPRIELEDAV
12429|gene|hma      IAPRIELEDAV
2861|gene|hhi       IAPRIELEDAV
                    : *.::*::*: