HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0506COG1602arCOG04269Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0506 nrc1 VNG0351 vng351 no entry
cHOG0506 hmu HMUK3192 Hmuk_3192 Protein of unknown function DUF650
cHOG0506 hma RRNAC3318 hypothetical protein
cHOG0506 hwa HQ1226A hypothetical protein
cHOG0506 hla HLAC0310 Hlac_310 Protein of unknown function DUF650
cHOG0506 hbo HBOR24810 Hbor_24810 uncharacterized conserved protein
cHOG0506 hut HUTA1972 Huta_1972 Protein of unknown function DUF650
cHOG0506 hvo HVO_0734 HVO_0734 conserved protein
cHOG0506 nph NP5182A hypothetical protein
cHOG0506 hhi 558 HAH_0558 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


5182|hp|nph       -------MRLDEYVDDIEQDDSVALR-KLAEEKSYAVTEYIDDARTRFDETLTDDTLVGS
351|chp|nrc1      MATLRSGVHLDEYIDDLQPDSEHQRRQQLAAEKSYEILDFVADVEQGVTEALQGDTLVGA
1972|hp|hut       -------MRLEDYIEGFERDEAAEKR-RLAEEKSYAITDHLEDVERQLEETLQGDALFGS
13318|hp|hma      -------MQLDEFIEGFEEDEAAQRR-RLAAEKSYAITDHLEDLEQQFEAAVQGDSLFGS
558|hp|hhi        -------MQLDEFIEGFEEDEAAQRR-RLAAEKSYAITDHLEDVEQQFEAAVQGDSLFGS
1226|hp|hwa       -------MRLDEYVD-IEQNKRAKRR-RLAKNRSYDIVEYLDDFQDRFESTVQGDSLYGG
310|gene|hla      -------MRLDEFIE-FEADERAERR-RLAAEKDYGILDHLDSFERRFEEHVSDDAVVGS
24810|hp|hbo      -------MRLDEYMDIAAESERAKRR-RLAQEKSYDILEHLEDFQNRFEETVQGDSLFGS
                         :.*:::::    ..    * .** :..* : :.: .    .   : .*:: *.

5182|hp|nph       TAPSVFVGRSSYPNVSAGVLAPVGDENDAEAYATTGEWYQQGFSIDDVFERRTGLLNSTR
351|chp|nrc1      TAPSVFVGRSAYPDVSAGILSPVAGDADPAEFATSGEWYQQGLGIDNVLQYRTGLLNSRR
1972|hp|hut       TAPEIFVGRSGYPNVSSGVLSPVADEGDPTDFATSGQWYANGLGIEDVLQRRTGLLNSQR
13318|hp|hma      TAPEIFVGRSGYPNVSTGLLSPVDTDAAAAGFATSGDWYQEGLGIEDVLQRRTGMVNSTQ
558|hp|hhi        TAPEIFVGRSGYPNVSTGLLSPVDTDAAAAGFATSGDWYQEGLGIEDVLQRRTGMVNSTQ
1226|hp|hwa       VSPSIFVGTSNYPHVSTGVLSPVGHNDDVSQFITSDTWYNEDISISDVFERRASLLNSTT
310|gene|hla      VSPSIFVGRSNYPNVSTGLLSPVGREERAARFETSAAWYDEGVSIADVFDRRTSLLNSTR
24810|hp|hbo      VSPSIFVGQSNYPNVSTGILSPVGHEDDAAKFETSAGWYDEGVSINDVFQRRTSLLNSNR
                  .:*.:*** * ** **:*:*:**  :     : *:  ** :...* :*:: *:.::**  

5182|hp|nph       RSNVD------------VYDVWD--GFVGTQREVALADDPVDIELGLDDRPGFDL-DGPL
351|chp|nrc1      AANVN------------VHDVWD--GFVGTQREVAMADRPVDVEIGLSDAPTFDREEYTS
1972|hp|hut       SAKVD------------VNDVWD--GFVGTQREVAIADRPVDVEIGLDGTP--DF-DLTT
13318|hp|hma      TTSVDSVSAGGGRGTSGVHDVWN--GFVGVQREVAIADHPVDVEVGLDGTP--EM-DVNF
558|hp|hhi        TTSVDSVSAGGGRGTSGVHDVWN--GFVGVQREVAIADHPVDVEVGLDGTP--EM-DVNF
1226|hp|hwa       TRPVTN-----------VAETWDGDGFLGTQREIAIADHPVTVEIGLVNRPNIDF-DVNP
310|gene|hla      GADVADAGRDGG----GVHDAWN--GWLGVQREVAIADRPVDVEIGLDGTPDLDF-DIGT
24810|hp|hbo      PTEVQN-----------VNDAWD--GFLGVQREVAIADRPVSVEIGLDSRPDIDF-DVSL
                     *             * :.*:  *::*.***:*:** ** :*:** . *  :  :   

5182|hp|nph       EDIAAPRGPRAFAESARVTENPSVPRAIEKTLSDDDWRAEGAITYLYRRGFDVYDINNVL
351|chp|nrc1      PAANAPSGPNASAESAALGENPHVPRYVEKTLADDDWAAEGAMTYLYRRGLDVYQINRVL
1972|hp|hut       DDISTPTGPRARATEATLAENPHVPRPVEKTLEDDDWRAEGAMTYLYRKGFDVYDVNTIL
13318|hp|hma      DDVGTPTGPRAHATGADLAENPHVPRPVEKTLSDDDWRAEGAMAYLYRRGFDVYDINTIL
558|hp|hhi        DDVGTPTGPRAHATGADLAENPHVPRPVEKTLSDDDWRAEGAMAYLYRRGFDVYDINTIL
1226|hp|hwa       ADVSTPVGPRARAESATLSENPHVPRAVEKTISDDDWNAEGAITYLYRRDFDIYDINTIL
310|gene|hla      EDIKTPTGPRAAARTADLGENPHVPRPVKKTLEDDDWRAEGAMTYLYRRGFDVYDINTIL
24810|hp|hbo      DDVATPVGPRARAQSADLAENPHVPRPVQKTLEDDDWNAQGAMNYLYRRGFDVYDINTIL
                      :* **.* *  * : *** *** ::**: **** *:**: ****..:*:*::* :*

5182|hp|nph       SVGALGEAENRRLVPTRWSITAVDDTVGQYLRGTIRNAPPIDRTLVWHTSYMGNDYWVVA
351|chp|nrc1      SVGALGQGHHRRLVPTRWSITAVDDTVGQYLRGTIRDAPSVDEVTVHVNEYMGNRYWVVL
1972|hp|hut       SAGALGQGANRRLVPTRWSITAVDDTVGQYLHGQIRNANTIDETQVWYNEYMGNRYWIIL
13318|hp|hma      SAGALGQASERSLVPTRWSITAVDDTVGQYVRGTLRNADTIDKPELWYNEYMGNRYWVVL
558|hp|hhi        SAGALGQASERSLVPTRWSITAVDDTVGQYVRGTLRNADTIDKPELWYNEYMGNRYWVVL
1226|hp|hwa       SAGALGRTDQRRLVPTRWSITAVDDVIGRYLRGRIRTNQDINSVEIHRESFLGNAFWVIL
310|gene|hla      SAGALGRGKNRRLVPTRWSITAVDDTVGQFLRGSIRDNPTVNRIEVHRNEYLGNAFWVIL
24810|hp|hbo      SAGALGQGDNRRLVPTRWSITAVDDTVGQFLRGRIQTNPSINTVEIHRNEFLGNAFWVIL
                  *.****    * *************.:*.::.* :.    ::   :.  .::** :*:: 

5182|hp|nph       APGDWEFELLELKAPGSIWNPDPDGQLYMAADNEGYDGRSGYVEETSGAYYAARLGVLEA
351|chp|nrc1      APGRWEHELVEMKAPGSIWNPDPGGDLWMAAASEGYEGRTGYVDETAGAYYAARLGVLEH
1972|hp|hut       TPGDWEFELVEMKAPESVWNPLGET-HYLASAHEGYEGRTSYVEETAGAYYASRLGVLEH
13318|hp|hma      APGRWEFELVEMKAPQSVWNPRPETGYYMSSAHEGYEGRTAYVEETAGAYYAARLGVLEH
558|hp|hhi        APGRWEFELVEMKAPQSVWNPRPETGYYMSSAHEGYEGRTAYVEETAGAYYAARLGVLEH
1226|hp|hwa       APGEWEYELVEMKAPGSIWNPKPEAGTAITTDWEGREGRTKYVSETAGAYHAARLGVLEH
310|gene|hla      VPGQWEYELVEMKSPGSIWNPDPGAGVYLSAASEGREGRTGYVEETAGAYYAARMGVLEH
24810|hp|hbo      APGNWEFELVEMKAPGSVWNPDPEAGMWLSSDSEGFEGRTGYVEETAGAYHASRLGVLEY
                  .** **.**:*:*:* *:***       :::  ** :**: **.**:***:*:*:**** 

5182|hp|nph       LADRDRQAKVFVVRYATEAYWAPVGVWQIRESVRDAFD----------GEPAVAETFHDA
351|chp|nrc1      LSDIGRQAKALVLREVSDDYWAPVGVWQVRESVRNAFD----------GQPGEAETFHGA
1972|hp|hut       LVDIDRQAKCLVLREVTDDYWAPVGVWQVREGVRNAFEDPEGLPDALSGRYGEAGSFRDA
13318|hp|hma      LQERDKQAKCLVLREITDDYWAPVGVWQVREGVRNAFD----------GEPGTAQSFRET
558|hp|hhi        LQERDKQAKCLVLREITDDYWAPVGVWQVREGVRNAFD----------GEPGTAQSFKET
1226|hp|hwa       LAQRGRRAKALILRHISADYWAPVGVWQVRETVRDTFD----------DTPAISETMHEA
310|gene|hla      LDDRGRQAKALVLRHVSDDYWGPVGVWQVREAVRNAFE----------GEHGTAETFGEA
24810|hp|hbo      LDQQGRQAKALILRHVSDDYWGPAGVWQVRESVRNAFD----------GERAEAETFAAA
                  * : ...** :::*  :  **.*.****:** **::*:          .  . : ::  :

5182|hp|nph       VRQLVPQLPVSMAALRRKSTMAAGVQADLSAFGAGGDSSRSR
351|chp|nrc1      VAEISDHLPVSLAALRRKSDMVAGVQSALSEFA---------
1972|hp|hut       VTSVTEQLPVSLTALRRKSEMVAGLQATLSDF----------
13318|hp|hma      LTAIADQLPVSLGQLRRKSELVAGLQSQLSDF----------
558|hp|hhi        LTAIADQLPVTLGQLRRKSELVAGLQSQLSDF----------
1226|hp|hwa       IDGVCEHLPISSARLHRASTIAAGRQATFDTFT---------
310|gene|hla      VRGVADHLPVPLGRLRRKSTMAAGLQANLGDFVDAG------
24810|hp|hbo      VRQVTEYLPVSLGDLRRKSTMASGLQMNLRDFS---------
                  :  :   **:.   *.* * :.:* *  :  *