HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0504COG1031arCOG01359Uncharacterized Fe-S oxidoreductaseputative oxidative cyclase

HOG Organism Gene ID Name Annotation
cHOG0504 nrc1 VNG0284 oxc putative oxidative cyclase
cHOG0504 hmu HMUK3028 Hmuk_3028 Radical SAM domain protein
cHOG0504 hma RRNAC1872 radical HhH
cHOG0504 hwa HQ1173A Fe-S oxidoreductase
cHOG0504 hla HLAC0639 Hlac_639 hypothetical protein
cHOG0504 hbo HBOR24450 Hbor_24450 uncharacterized Fe-S oxidoreductase
cHOG0504 hut HUTA1190 Huta_1190 Radical SAM domain protein
cHOG0504 hvo HVO_0768 HVO_0768 radical HhH
cHOG0504 nph NP5312A Fe-S oxidoreductase
cHOG0504 hhi 2388 HAH_2388 radical HhH
MUSCLE (3.6) multiple sequence alignment


639|hp|hla          --M--PSE------------P---------------------------------------
5312|gene|nph       --MQDPADLDVTIVDGYVDEPAHFGVPPYISTYPRFAAGAAVDAGVDPDSITYHTIDELR
284|chp|nrc1        --MIAPEDLDVTLVDGYVDEPAHFGVPPYISTYPRYTAGALVDAGVDPANVTYHTIDELR
1173|gene|hwa       MTHIHPSNLSVTLVDGYVDEPAHFGVPPYISTYPRFTAGALVDAGVPHDQITYHTIDALR
24450|hp|hbo        --MTDPADLTVTLVDGYVDEPAHFGVPPYISTYPRFTAGALVDAGVPEENVTYHTIDELR
11872|gene|hma      --MTDPETLDVTIVDGYVDEPAHFGVPPYISTYPRYAAGALVDAGVPREQITYHTIDELR
2388|gene|hhi       --MTDPETLDVTIVDGYVDEPAHFGVPPYISTYPRYAAGALVDAGVPRKQITYHTIDELR
1190|gene|hut       --MTDPADLTVTIVDGYVDEPAHFGVPPYISTYPRYVAGALVDAGVPHESITYHTIDGLR
                         *              *                                       

639|hp|hla          -------------------------------PPDPDP-----------------------
5312|gene|nph       ESRRLWEDVADADLFVYVGGMTVPGKYVGGTPAEPDEVRKLAWTAEGVSVMGGPVRFGVG
284|chp|nrc1        GDTAKFNDVADADLFVYVGGMTVPGKYVGGTPAEPDEVRELAWLADGTSVMGGPVRFGVG
1173|gene|hwa       DDRGRWRDVADADLLIYLGGMTVPGKYVGGTPAEPDEVREIAWTADGVSMMGGPVRFGVG
24450|hp|hbo        DDRQKWADVADADLMLYIGGMTVPGKYVGGTPAEPDEVRELAWTADGVSVMGGPIRFGVG
11872|gene|hma      EDNAVWRDVEAADLMVYVGGMTVPGKYVGGTPAEPDEVRELAWTANGTSIMGGPVRFGVG
2388|gene|hhi       EDNAVWRDVEAADLMVYVGGMTVPGKYVGGTPAEPDEVRELAWTADGTSIMGGPVRFGVG
1190|gene|hut       EENRRWQAVEEADLTVYVGGMTVPGNYVGGTPAEPDEVRRIAWTADGTSLMGGPVRFGVG
                                                   *.:**                        

639|hp|hla          -SPADDTQSRRQRVGQ-YVALGAV------------------------------------
5312|gene|nph       EANEGATETKRQNLDYDFLALADIEAAVYDLLHGGLEGFEDRYRDNEELDRWARKGAFIV
284|chp|nrc1        EENAGAQEMERSDLDFDFLAMADIEAAAYDLVDNGLEGFEDRYRDNQEINRWAAKGAFVV
1173|gene|hwa       DENAGAQEMERQNLDYDYLAMADVEAAAYDLVESGLEGFNDRYRSTDELDRWASKGAFIV
24450|hp|hbo        EENAGAQEMERRNLDYDYLAMADVEAAAYDLVDSGLEGFNNRYRDNEELDRWAAKGAFVV
11872|gene|hma      EANEGASETARDDLDFDFLAMADVEAAVFDLVESGLEGFNDRYRDIEEETRWARAGAFVV
2388|gene|hhi       EANEGASETARDDLDFDFLAMADVEAAVFDLVDSGLEGFNDRYRDIEEETRWARAGAFVV
1190|gene|hut       DENEGASEPERDDLDFDFLAGADIEAAVFDLVENGLEGFDPRYRTMDESSRWAREGAFIV
                        .  :  *  :.  ::* . :                                    

639|hp|hla          -----------------------CAYAAVQFY----------------------------
5312|gene|nph       EQHPDHPDYLICELETSRGCPYRCSFCTEPMYGDPTFRTPDSVVSEVGGLADHGVRHFRL
284|chp|nrc1        EQHPNYPEYLICEMETSRGCAYRCSFCTEPMYGDPSFRSADAVVTEVGELYAHGARHFRL
1173|gene|hwa       VQHPNYPEYLICEIETSRGCAYRCSFCTEPMYGDPSFRTADSVIREVESLADRGVAHFRI
24450|hp|hbo        EQHPNHPDYLICEMETSRGCAYRCSFCTEPMYGNPAFRTAESVVREVENLSARGAKHFRL
11872|gene|hma      EQHPNHPDYLICEMETSRGCPYRCSFCTEPMYGNPDFRPPESVVDEVDALSDRGVKHFRL
2388|gene|hhi       EQHPNHPDYLICEMETSRGCPYRCSFCTEPMYGNPDFRPPESVVDEVDALSDRGVKHFRL
1190|gene|hut       EQHPNHPDYLICEIETGRGCAYRCSFCTEPLYGDASFREPDAVVSEVDALSDHGVTNFRL
                                           *::.:  :*                            

639|hp|hla          ------------GADPRP------------------------------------------
5312|gene|nph       GRQADILAYGGDGEAPNPDALRELYGGIRDVVPDLGTLHLDNMNPVTITDYPEKSREGIR
284|chp|nrc1        GRQADILAFGGDGEAPNPDALRDLYGGIREVAPELGTLHLDNMNPVTIVDYPEKSRDAIR
1173|gene|hwa       GRQADILAFGGDGEAPNPDALRRLYSGIRDVAPDLQTLHLDNMNPITIVNWPDASRECLD
24450|hp|hbo        GRQADILAFGGDGEAPNPDALRRLYGGIREVAPDLQTLHLDNMNPITVVKWPEKARECIR
11872|gene|hma      GRQADILAYGGDGEAPNPDALRRLYGGIRDVAPDLETLHLDNMNPITVVKWPEKAREGIR
2388|gene|hhi       GRQADILAYGGDGEAPNPDALRRLYGGIRDVAPDLETLHLDNMNPITVVKWPEKAREGIR
1190|gene|hut       GRQADILAYGGDGEAPNPDALRELYRGIRKVAPGLETLHLDNMNPITVVKWPEKAREGIR
                                *  *.*                                          

639|hp|hla          -------------WGL-----------------------------AAGWA----------
5312|gene|nph       VIAEHNTPGDTAAFGLESADPVVREKNNLLVSAEECLEAVRIVNEAGGWR----------
284|chp|nrc1        VIAEHNTPGDTAAFGLESADPLVQEENHLLVSAEECLEAVRIVNEVGGWR----------
1173|gene|hwa       IISTYNTPGDTAAFGLESADPVVQDQNQLNVTADECFEAVRIVNEVAGWR----------
24450|hp|hbo        IIAEHNTPGDTAAFGLESADPVVQEANTLNVTADECFEAVKIVNEEAGWR----------
11872|gene|hma      IIAEHNTPGDTAAFGLESADPNVMSDNNLNVTADQCFEAVKIVNEVAGWR----------
2388|gene|hhi       IIAEHNTPGDTAAFGLESADPNVMSDNNLNVTADQCFEAVKIVNEVAGWR----------
1190|gene|hut       IIAEHNTPGDTAAFGVESADPAVQSDNNLNVTADEALEAVRIVNEEGGFRPGARSEATGS
                                 :*:                              .*:           

639|hp|hla          -------------AATAVILGPAAWVARDRLP---P----------DRLETLTY------
5312|gene|nph       ---------PGEAPGSGPSV-DA---NADRLPKLLPGINLVHGLEGERAETFEHNKQFLQ
284|chp|nrc1        ---------PGESPADAPSWGEG---SPDRLPKLLPGINLLHGLTGERAETFEHNKQFLH
1173|gene|hwa       ---------PGEDPADAPSYGIE---APDRLPKLLPGINLLHGLTGERTETFAHNKRFLH
24450|hp|hbo        ---------PGETPDNAPTHGPD---ASNRLPKLLPGINLLHGLKGEREETFEHNKRFLH
11872|gene|hma      ---------PGGDKDTAPNFGDD---AARRLPKLLPGINLVHGLKGETRETFEHNKRFLQ
2388|gene|hhi       ---------PGGDKDTAPNFGDD---AARRLPKLLPGINLVHGLKGETRETFEHNKRFLQ
1190|gene|hut       GRASGDSREPGGDRDNAPTFGDD---AARGLPKLLPGINFVHGLKGETAETFEHNKRFLQ
                                    .             **   *          :  **: :      

639|hp|hla          VAFGAAILAIPVGLGAALAFE----------------VPFFPYG----------------
5312|gene|nph       DVYDEGLMLRRINIRQVMAFEGTEMAETGADIAHDHKQQFKTYKQAVREEIDNPMLQRVA
284|chp|nrc1        SLLDEGLMVRRINIRQVMAFEGTEMADTGVDLAQNHKQLFKQYKTDVRETIDNAMLQRVV
1173|gene|hwa       RVFDAGLLLRRINIRQVMAFEGTEMAETGADVAIEHKKQFKQYKQEVREEIDQPMLRRLV
24450|hp|hbo        RVYDAGLMVRRINIRQVMAFEGTEMADEGANIAKEHKKRFQAYKKQVREEIDQPMLRRVA
11872|gene|hma      RVYDEGLMLRRVNIRQVMAFEGTDMADTGAEIAKDHKQLFKQYKQEVRETIDNPMLQRVA
2388|gene|hhi       RVYDEGLMLRRVNIRQVMAFEGTDMADTGAEIAKDHKQLFKQYKQEVRETIDNPMLQRVA
1190|gene|hut       RILDEGLMIRRVNIRQVMAFPGTEMDETGAEIAQDHKRQFQAYKREVRETIDNPMLQRVA
                       . .::   :.:  .:**                   *  *                 

639|hp|hla          -PGFLV--------------GVALGT---LVVFLAERTV------------------VPE
5312|gene|nph       PPGTVLPNVYLEYHEDGRTFGRQLGTYALLVALPGERELGRTVDVAVTDHGYRSVSGVPY
284|chp|nrc1        PPGTVLKDVTLEYHQDGKTFGRQLGTYSLLVAIPGERELGQTIDVAITDHGYRSVTGVPH
1173|gene|hwa       PAGTVLPDVYLEYHRDGRTFGRQLGTYPLLVGIPGERPLGKMIDVAVVDHGYRSITAVPY
24450|hp|hbo        PAGTVLPNVHLEYHQDGKTFGRQLGTYPLLVGIPGERELGQTIDVAVVDHGYRSVTGVPH
11872|gene|hma      PPGTVLPDVHLEYHQDGKTFGRQLGTYPLLVGIPGERELGSVVDIAVTDHGYRSVTGVPY
2388|gene|hhi       PPGTVLPDVHLEYHQDGKTFGRQLGTYPLLVGIPGERELGSVVDIAVTDHGYRSVTGVPY
1190|gene|hut       PPGTILEDVHLEYHQDGKTFGRQLGTYPLLVGIPGERPLGKTIDVAITDHGYRSVTGVPH
                     .* ::              *  ***   ** : .** :                  ** 

639|hp|hla          RL-------------RGAGI----------------------------------------
5312|gene|nph       PLDINAASMDELRALPGIGKQRAGNLFVDRPHETVPNL--DDGPDLGTFCVTGG--SGSA
284|chp|nrc1        PLDLNDASMDELTAIPGIGSSTAGDILVARPHDSAPPV--AD-ADLAKFTQ---------
1173|gene|hwa       PLDPNAASMDELTAIPGIGSRTAGDIVINRPYDGLADVPVSD-VDLSTFTHASGYDEPRA
24450|hp|hbo        PLDPNEASMDELTSIPGIGKRTAGDIVINRPYASADEVSAAD-VDFSKFTDSYPV-EHRA
11872|gene|hma      PLDLNSASMNELTEIPGIGRSTAGDVVVNRPYESVGDI--DV-ASIERFATTRS--QEGA
2388|gene|hhi       PLDLNSASMNELTAIPGIGRSTAGDVVVNRPYESVGDI--DV-ASIERFATTQS--QEGA
1190|gene|hut       PLDLNAASMDELQALPGIGSQTAGNIIVGRPYDSTPDI--EG-VDFEAFTTIG---RESP
                     *              * *                                         

639|hp|hla          -
5312|gene|nph       D
284|chp|nrc1        -
1173|gene|hwa       D
24450|hp|hbo        D
11872|gene|hma      D
2388|gene|hhi       D
1190|gene|hut       S