HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0503COG0041arCOG02464Phosphoribosylcarboxyaminoimidazole (NCAIR) mutasephosphoribosylaminoimidazole carboxylase catalytic subunit

HOG Organism Gene ID Name Annotation
cHOG0503 nrc1 VNG0633 purE phosphoribosylaminoimidazole carboxylase catalytic subunit
cHOG0503 hmu HMUK1916 Hmuk_1916 phosphoribosylaminoimidazole carboxylase, catalytic subunit( EC:4.1.1.21 )
cHOG0503 hma RRNAC1446 purE phosphoribosylaminoimidazole carboxylase catalytic subunit
cHOG0503 hwa HQ1636A purE phosphoribosylaminoimidazole carboxylase catalytic chain
cHOG0503 hla HLAC0703 Hlac_703 phosphoribosylaminoimidazole carboxylase, catalytic subunit
cHOG0503 hbo HBOR21480 Hbor_21480 phosphoribosylaminoimidazole carboxylase, PurE protein( EC:4.1.1.21 )
cHOG0503 hut HUTA0707 Huta_0707 phosphoribosylaminoimidazole carboxylase, catalytic subunit
cHOG0503 hvo HVO_0977 HVO_0977 purE phosphoribosylaminoimidazole carboxylase catalytic subu
cHOG0503 nph NP2290A purE phosphoribosylaminoimidazole carboxylase, catalytic subunit
cHOG0503 hhi 2027 purE1 phosphoribosylaminoimidazole carboxylase catalytic subunit
MUSCLE (3.6) multiple sequence alignment


633|gene|nrc1       ------MT-TVSDLIDLFETEAAADHPPDETPDVGVIMGSDSDLDVMA-------GAHDA
1636|gene|hwa       MPAHTPNEPTIQALLDRLHTQADTDLTTAETPDVGIIMGSDSDLDTMV-------GAHEA
703|gene|hla        ------MT-TVQDLIDRLEAEAAADADPETTPDVGIIMGSDSDLPTME-------GAYDA
21480|gene|hbo      MTADTDDV-TVESLIDRLRAEADADADPETTPDVGIIMGSDSDLDVMC-------GAHEA
2290|gene|nph       ---MTRSE-EVAALIDLFEAEAERDRSDAETPDIGIVMGSDSDLDTMY-------GAYEA
707|gene|hut        ----MTSE-SVQSLIDQLEAEAAMDRPVEATPEIGIIMGSDSDLDVMAGSESGRPGAFDV
11446|gene|hma      ----MPAD-NVQSLIDQLHEEAEMDRPNDLTPDVGIIMGSDSDLPTMAGGQGKRPGAYAA
2027|gene|hhi       ----MPAD-SVQSLIDQLREEAEMDRPNDLTPDVGIVMGSDSDLPTMAGGQGKRPGAYAA
                              :  *:* :  :*  *     **::*::******* .*        **. .

633|gene|nrc1       L-TDLGFTELTDYDDPPTG-YTFESWVVSAHRTPTLMDAYARTAAARGLDVIIAGAGGKS
1636|gene|hwa       L-DKLGFDEQTEFMTSPDARFTYETYVVSAHRTPQVLYAYGETAADRGIDVIIAGAGGKS
703|gene|hla        L-DELGFAEQTDFDDAPDARFTYESYVVSAHRTPELMYAYGETAAARGLDIVIAGAGGKS
21480|gene|hbo      L-DELGFEEQTDFTDAPDARFTYETYVVSAHRTPDLMYAYGQTAMDRGLDVIIAGAGGKS
2290|gene|nph       L-TELGFEEVTDYDDPPESRFTFETFVVSAHRTPELMYAYGETARDRGLDVIIAGAGGKS
707|gene|hut        LTEELGFEEQTDYETAPEARFTFETFVVSAHRTPELMYTYAETAEDRGLDVIIAGAGGKS
11446|gene|hma      LADELGFEEQTDYTDAPESRFTFETFVCSAHRTPDLMYAYAETAADRGIDVIIAGAGGKS
2027|gene|hhi       LADELGFEEQTDYTDAPESRFTFETFVCSAHRTPDLMYAYAETAADRGIDVIIAGAGGKS
                    *  .*** * *::  .* . :*:*::* ****** :: :*. **  **:*::********

633|gene|nrc1       ADLPNMTASLAYPIPVVGVPVQEKSVPSVIGMPTGAPITAVDAGKSYNAGLAAAQFLATD
1636|gene|hwa       ADLPNMTASIAYPIPVIGVPVQEKSVDSVIGMPTGAPIVAVDAGKSHNAALSAAQILSRE
703|gene|hla        ADLPNMTASLAYPIPVIGVPVQEKSVDSVIGMPTGAPIVAVDAGKSFNAGLSAAQVLARE
21480|gene|hbo      ADLPNMTASIAYPLPVVGVPVQEKSVDSVIGMPTGAPIVAVDAGKSFNAALSAVQMLARE
2290|gene|nph       ADLPNMTASIAYPLPVVGVPVHEKSVSSVIGMPTGAPIVAVDAGKSFNAALSAVQMLARG
707|gene|hut        ADLPNMTASIAYPLPVIGVPVQEKSLPSVIGMPQGAPIVAVDAGKSFNAALSAVQILARQ
11446|gene|hma      ADLPNMTASIAYPLPVIGVPVQEKSVDSVIGMPQGAPMTAVDAGKSFNAALSAAQILARQ
2027|gene|hhi       ADLPNMTASIAYPLPVIGVPVQEKSVDSVIGMPQGAPLTAVDAGKSFNAALSAVQILARQ
                    *********:***:**:****:***: ****** ***:.*******.**.*:*.*.*:  

633|gene|nrc1       DPTLADRLRDLQAARQEGVADVSARLHSQGTDSLRSPQN-------
1636|gene|hwa       HDVLKTRLEEYHTALITDVAADSFRMHDAGVNTFRANNDESGTSNE
703|gene|hla        HDAIEERLIEYHEELKGGVAEVSADLHDLGIDGFRDRNEP------
21480|gene|hbo      HDVLEDRLLEYHESLTGGVARDSRDLHDMGLTEYVESRKE------
2290|gene|nph       HPELEARLEAYHDDLQDNVGAVSKRLHEQGTDRFRESR--------
707|gene|hut        HPELQERLLAYHEGLQQGVGEVSRDLHERGTPGFRDT---------
11446|gene|hma      HDELRDRLVSYHEGLQADVGEASRDLHELGTPGFKREYWDE-----
2027|gene|hhi       HDELRDRLVSYHEGLQTNVGEASRDLHELGTPGFKREYWDE-----
                       :  **   :     .*.  *  :*. *