HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0502COG0464KOG0741 KOG0730 KOG0732 KOG0733 KOG0735 KOG0736 KOG0737 KOG0739 KOG0740arCOG01308ATPases of the AAA+ classcell division cycle protein

HOG Organism Gene ID Name Annotation
cHOG0502 nrc1 VNG1667 cdc48c cell division cycle protein
cHOG0502 hmu HMUK1780 Hmuk_1780 AAA family ATPase, CDC48 subfamily
cHOG0502 hma RRNAC1527 cdc48d cell division control protein 48
cHOG0502 hwa HQ3177A aaa AAA-type ATPase (transitional ATPase homolog)
cHOG0502 hla HLAC1716 Hlac_1716 AAA family ATPase, CDC48 subfamily
cHOG0502 hbo HBOR08130 Hbor_08130 AAA family ATPase, CDC48 subfamily
cHOG0502 hut HUTA2618 Huta_2618 AAA family ATPase, CDC48 subfamily
cHOG0502 hvo HVO_2380 HVO_2380 cdc48 cell division control protein 48
cHOG0502 nph NP3072A AAA-type ATPase (transitional ATPase homolog)
cHOG0502 hhi 2099 cdc48d cell division control protein 48/AAA family ATPase
MUSCLE (3.6) multiple sequence alignment


1667|gene|nrc1      MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
2618|gene|hut       MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
3072|gene|nph       MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
11527|gene|hma      MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGSDTTAAKVWRADRQDWN
2099|gene|hhi       -----MEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGSDTTAAKVWRADRQDWN
1716|gene|hla       MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
3177|gene|hwa       MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGADTTAAKVWRADRQDWN
8130|gene|hbo       MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGGETTAAKVWRADRQDWN
                         :*************************************.:***************

1667|gene|nrc1      TDTIRIDGFTRQNAEVGIGERVKIRKADAEKADTLVLAPPEEASVQFGSDAAGMVKRQIL
2618|gene|hut       TDTVRIDGFTRQNADVGIGERVEIRKAEAEKADSLVLAPPEEASVQFGSDAAGMVKRQIL
3072|gene|nph       TDTVRIDGFTRQNADVGIGERVTIRKADATKADKLVLAPPEDASVQFGSDAAGMVKRQIL
11527|gene|hma      TDTVRIDGFTRQNADVGIGERVTIRKAEAEKADKLVLAPPEEASVQFGSDAAGMVKRQIL
2099|gene|hhi       TDTVRIDGFTRQNADVGIGERVTIRKAEAEKADKLVLAPPEEASVQFGSDAAGMVKRQIL
1716|gene|hla       TDTVRVDGFTRQNADVGIGERVTIRKAEAEKAEKLVLAPPEEASVQFGSDAAGMVKRQIL
3177|gene|hwa       TDTVRVDGFTRQNADVSIGERVTIRKAETTKAEKLVLAPPEEASVQFGSDAAGMVKRQIL
8130|gene|hbo       TDTVRIDGFTRQNADVGIGERVTIRKAEATKAEKLVLAPPEEASVQFGSDAAGMVKRQIL
                    ***:*:********:*.***** ****:: **:.*******:******************

1667|gene|nrc1      KRPVVARDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLVTEDTDVELREEPISGFE
2618|gene|hut       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVVLITEDTDVELREEPISGYD
3072|gene|nph       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETDPDGVCLITEDTEVELREEPISGFE
11527|gene|hma      KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLITEDTEVELREEPISGFE
2099|gene|hhi       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLITEDTEVELREEPISGFE
1716|gene|hla       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVDTEPDGVCLITEDTEVELREEPISGFE
3177|gene|hwa       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVNTEPDGVCLVTEDTEVELREEPISGFE
8130|gene|hbo       KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETDPEGVCLVTEDTEVELREEPISGFE
                    ***** ***************************:*:*:** *:****:**********::

1667|gene|nrc1      RTGGGITYEDIGGLENEIQRVREMVELPMKHPQIFQKLGIEPPQGVLLHGPPGTGKTLLA
2618|gene|hut       KTGGGITYEDIGGLENEIQRVREMVELPMKHPQIFKKLGIEPPSGVLLHGPPGTGKTLLA
3072|gene|nph       KTGGGITYEDIGGLQNEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
11527|gene|hma      KTGGGITYEDIGGLQNEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
2099|gene|hhi       KTGGGITYEDIGGLQNEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
1716|gene|hla       KTGSGITYEDIGGLQSEIQRVREMVELPMKHPQIFSKLGIEPPQGVLLHGPPGTGKTLLA
3177|gene|hwa       KTGGGITYEDIGGLQNEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
8130|gene|hbo       KTGGGITYEDIGGLQGEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
                    .**.**********:.*******************.*******.****************

1667|gene|nrc1      KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDAKDDSPSIIFIDELDSIAPKRED
2618|gene|hut       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDATEESPSIIFIDELDSIAPKRED
3072|gene|nph       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDATEESPSIIFIDELDSIAPKRED
11527|gene|hma      KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDASEESPSIIFIDELDSIAPKRED
2099|gene|hhi       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDASEESPSIIFIDELDSIAPKRED
1716|gene|hla       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDAKEESPSIIFIDELDSIAPKRED
3177|gene|hwa       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDATEESPSIIFIDELDSIAPKRED
8130|gene|hbo       KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDAKEESPSIIFIDELDSIAPKRED
                    **************************************.::*******************

1667|gene|nrc1      VTGEVERRVVAQLLTMMDGLEGRGQVIVIAATNRVDAVDPALRRPGRFDREIEIGVPDEI
2618|gene|hut       VTGEVERRVVAQLLTMMDGLESRGQVVVIAATNRVDSVDPALRRPGRFDREIEIGVPDET
3072|gene|nph       VTGEVERRVVAQLLTMMDGLESRGQVIVIAATNRVDSVDPALRRPGRFDREIEIGVPDET
11527|gene|hma      VTGEVERRVVAQLLTMMDGLESRGQVIVIAATNRVDSVDPALRRPGRFDREIEIGVPDEV
2099|gene|hhi       VTGEVERRVVAQLLTMMDGLESRGQVIVIAATNRVDSVDPALRRPGRFDREIEIGVPDEV
1716|gene|hla       VTGEVERRVVAQLLTMMDGLETRGQVVVIGATNRVDSVDPALRRPGRFDREIEIGVPDEV
3177|gene|hwa       VTGEVERRVVAQLLTMMDGLETRGQVIVIGATNRVDSVDPALRRPGRFDREIEIGVPDEV
8130|gene|hbo       VTGEVERRVVAQLLTMMDGLETRGQVIVIAATNRVDSVDPALRRPGRFDREIEIGVPDES
                    ********************* ****:**.******:********************** 

1667|gene|nrc1      GREEILKIHTRGMPLSDDVNLSTLADDTHGFVGADIESLSKEAAMRALRRYLPEIDLDEE
2618|gene|hut       GREEILKIHTRGMPLSDDVDLPGLAEDTHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
3072|gene|nph       GRKEILQIHTRGMPLADDVDLDKMADETHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
11527|gene|hma      GREEILQIHTRGMPLSDDVNLAKLATDTHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
2099|gene|hhi       GREEILQIHTRGMPLSDDVNLAKLATDTHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
1716|gene|hla       GRKEILQIHTRGMPLSDDVSLDHLADETHGFVGADIESLTKEAAMKALRRYLPEIDLDDE
3177|gene|hwa       GRKEILQIHTRGMPLSDDVSLDYLADETHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
8130|gene|hbo       GRKEILQIHTRGMPLSDDVSLDHLADETHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
                    **:***:********:***.*  :* :************:*****.************:*

1667|gene|nrc1      DIPPSLIDRMIVKREDFKGALSEVEPSAMREVLVELPKITWDDVGGLTEAKNNVKESVEW
2618|gene|hut       DIPPSLIDRMIIKRDDFKGALNEVSPSAMREVLVELPKISWDDVGGLESAKNDVQESIEW
3072|gene|nph       DIPPSLIDRMIIKRQDFRGALNEVDPSAMREVLVELPKVSWDDVGGLTEAKEQVQESVEW
11527|gene|hma      DIPPSLIDRMIIKRDDFKGALNEVSPSAMREVLVELPKMSWDNVGGLSGPKEQVQEAVEW
2099|gene|hhi       DIPPSLIDRMIIKRDDFKGALNEVSPSAMREVLVELPKMSWDNVGGLSGPKEQVQEAVEW
1716|gene|hla       EVPPSLIDRMIVKRDDFGAALNEVEPSAMREVLVELPKISWDDVGGLSEAQQQVQESVEW
3177|gene|hwa       DVPPSLIDRMIVKRADFNDALSDVEPSAMREVLVELPKVSWDDVGGLEGPTQKVKESVEW
8130|gene|hbo       DIPPSLIDRMIVKRSDFEGALTEVEPSAMREVLVELPKVSWDDVGGLEDPKQKVKESVEW
                    ::*********:** **  **.:*.*************::**:****  . :.*:*::**

1667|gene|nrc1      PLNQPEKFTRMGVEPPAGVLLYGPPGTGKTLMAKAVANETNANFISVRGPQLLSKWVGES
2618|gene|hut       PMTTPEKFERMGVAPPSGVLLYGPPGTGKTLMAKAVANETDANFISVRGPQLLSKWVGES
3072|gene|nph       PMNAGEKFSRMGIEPPSGVLLYGPPGTGKTLMAKAVANETNANFISVRGPQLLSKWVGES
11527|gene|hma      PMNSPEKFERMGVTPPSGVLLYGPPGTGKTLMAKAVANETDANFISVRGPQLLSKWVGES
2099|gene|hhi       PMNSPEKFERMGVTPPSGVLLYGPPGTGKTLMAKAVANETDANFISVRGPQLLSKWVGES
1716|gene|hla       PLSSPEKFDRMGVDPPKGVLLYGPPGTGKTLMAKAVANETNANFISVRGPQLLSKWVGES
3177|gene|hwa       PITSRGRFERMGIDAPKGVLLYGPPGTGKTLIAKAVANETNANFISVRGPQLLSKWVGES
8130|gene|hbo       PLTSRDKFERMGIEPPKGVLLYGPPGTGKTLIAKAVANETNANFISVRGPQLLSKWVGES
                    *:.   .* ***: .* **************:********:*******************

1667|gene|nrc1      EKAIRQTFRKARQVAPTVIFFDELDSLAPGRGQTG-GNNVSERVVNQLLTELDGLEEMEE
2618|gene|hut       EKAIRQTFRKARQVAPTVVFFDELDSLAPGRGGQGSGSNVSERVVNQLLTEMDGLEDMED
3072|gene|nph       EKAIRQTFRKARQVSPTIIFFDELDSLAPGRGGEV-GSNVSERVVNQLLTELDGLEEMDD
11527|gene|hma      EKAIRQTFRKARQVAPTIIFFDELDSLAPGRGGEM-GSNVSERVVNQLLTELDGLEEMED
2099|gene|hhi       EKAIRQTFRKARQVAPTIIFFDELDSLAPGRGGEM-GSNVSERVVNQLLTELDGLEEMED
1716|gene|hla       EKAIRQTFRKARQVSPTIIFFDELDSLAPSRGQEM-GNNVSERVVNQLLTELDGLEEMGD
3177|gene|hwa       EKAIRQTFRKARQVSPTVIFFDELDSLAPSRGGGT-GNNVSERVVNQLLTELDGLEENGN
8130|gene|hbo       EKAIRQTFRKARQVSPTIIFFDELDSLAPSRGNDM-GNNVSERVVNQLLTELDGLEENGD
                    **************:**::**********.**    *.*************:****:  :

1667|gene|nrc1      VMVIAATNRPDIIDPALIRSGRFDRLVQVGQPGIEGREQILKIHTQDTPLAADVSLRELA
2618|gene|hut       VMVIGATNRPDMIDPALIRSGRFDRLVYIGEPDVDGREEILDIHTDDSPLSPDVSLRELA
3072|gene|nph       VMVIGATNRPDMIDPALIRSGRFDRLVMVGEPDLDGREKILRIHTGDTPLAPDVSLRELA
11527|gene|hma      VMVIGATNRPDMIDPALIRSGRFDRLVMIGEPDIEGREQILKIHTDDTPLSPDVSLRELA
2099|gene|hhi       VMVIGATNRPDMIDPALIRSGRFDRLVMIGEPDVEGREQILKIHTDDTPLSPDVSLRELA
1716|gene|hla       VMVIGATNRPDMIDPALLRSGRFDRLVMIGQPDQEGRERILEIHTQDTPLAPDVTLREIA
3177|gene|hwa       VMVVAATNRPDMIDPALIRSGRFDRLVLIGQPGEEGREQILKIHTRNSPLAPDVSLREIA
8130|gene|hbo       VMVIGATNRPDMIDPALIRSGRFDRLVLIGQPGEEGREQILRIHTQSSPLAPDVSLREIA
                    ***:.******:*****:********* :*:*. :*** ** *** .:**:.**:***:*

1667|gene|nrc1      ERADGYVGSDLANIAREAAIEALRDDEDADDVGMAHFRAAMENVRPTITDDLMEYYDQVE
2618|gene|hut       EITEGYVGSDLESIAREAAIQALRESEDAEEIGMAHFRSALEGVRPTVTDDIREYFEQME
3072|gene|nph       EMTDGYVGSDLESITREAAIEALREDDDAEAVEMRHFREAVESVRPTITDDIRNYYEQIE
11527|gene|hma      EVSDGFVGSDLESIAREAAIEALREDDNAEEVEMRHFRQAMDSVRPTITDDIREYYEQME
2099|gene|hhi       EVSDGFVGSDLESIAREAAIEALREDDDAEEVEMRHFRQAMDSVRPTITDDIREYYEQME
1716|gene|hla       EITDGYVGSDLEGIAREAAIEALRDDDDAEEVEMKHFRRALESVRPTINDDILAYYEEVE
3177|gene|hwa       EITDGYVGSDLESIAREAAIEALREDGDAQEIEMRHFRKAMESVRATITDDLMNYYEDMQ
8130|gene|hbo       EITEGYVGSDLESIAREAAIEALREDDDAKEIEMRHFRKAMEAVRPTITDELMDYYEQMQ
                    * ::*:***** .*:*****:***:. :*. : * *** *:: **.*:.*::  *:::::

1667|gene|nrc1      DQFKGSQGPNVNSRQGSEHIGFQ
2618|gene|hut       DQFKGGGPDSRQ-PRGSDRIGFQ
3072|gene|nph       EEFRGGTPDGRR--QSGGRIGFQ
11527|gene|hma      EEFRGGSSPQRQ-AGTGGRIGFQ
2099|gene|hhi       EEFRGGSSPQRQ-AGTGGRIGFQ
1716|gene|hla       EQFKGGSGNAIR--DTGGKIGFQ
3177|gene|hwa       EEFKGGTQNRLTGGRQDGRIGFQ
8130|gene|hbo       DQFKGGARDQLT-DRRDGRIGFQ
                    ::*.*.          . .****