HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0500COG1537KOG2869arCOG01741Predicted RNA-binding proteinscell division protein pelota

HOG Organism Gene ID Name Annotation
cHOG0500 nrc1 VNG1506 pelA cell division protein pelota
cHOG0500 hmu HMUK2121 Hmuk_2121 translation factor pelota
cHOG0500 hma RRNAC0965 pelA cell division protein pelota
cHOG0500 hwa HQ1802A pelA cell division protein pelota
cHOG0500 hla HLAC2030 Hlac_2030 translation factor pelota
cHOG0500 hbo HBOR13920 Hbor_13920 cell division protein pelota
cHOG0500 hut HUTA2924 Huta_2924 translation factor pelota
cHOG0500 hvo HVO_2880 HVO_2880 probable translation factor pelota
cHOG0500 nph NP4344A pelA cell division protein pelota
cHOG0500 hhi 1595 pelA cell division protein pelota
cHOG0500 hhi 4204 HAH_4204 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4204|hp|hhi         MSKSVRCTVENR--------------------------------QRVRRAARALRETAPT
1506|gene|nrc1      MQLKDRHTVEGGRERITLVPESLDDLWHLAYVLEPGDFVAGDTHRRIQRNDDQMRDTGGE
2924|gene|hut       MRIAERERVEGGRERLTLVPESLDDLWHLTYVIEPGDRVAGDTTRRIQRNDDQMRDTGGE
1802|gene|hwa       MRIPSRGRGEEGKEQWTLVPENVDDLWHLSHVLEPGDRVGGDTTRRIQRNDENLRDTGGQ
2030|gene|hla       MRISDRGYGEEGRERLTLVPENVDDLWHLAHVLEPGDLVEGDTTRRIQRNDDQMRDTGGQ
13920|gene|hbo      MRISSRGRGEEGRERITLVPENVDDLWHLSHVLESGDLVSGDTTRRIQRDDDQMRDTGGQ
4344|gene|nph       MRIVDRESAEGRRERITLVPETLDDLWHLTYVLEPGDLVAGDTTRRIQRDDDKMRDTGGE
10965|gene|hma      MQIQSQETTAEGAERIEVVPETLDDLWHLSYVIEPGDLVSGDTTRRIQRNDDNLRDKGGE
1595|gene|hhi       MQIQSQETTAEGAERIEVVPETLDDLWHLSYVIEPGDLVSGDTTRRIQRNDDNLRDKGGE
                    *    .                                      .*:.*    :*:..  

4204|hp|hhi         ----------------------AVVGTTPPVRSEYDA-------------------WTLD
1506|gene|nrc1      REHMFVTIDVGDVEFHKFSNRLRVSGTIEDCSREDQLGLHHTLNVAEREELEVEKHWQPD
2924|gene|hut       REHIWAALDVDDVEFARFADRLRVSGVIGDCSREDQLGQHHTINVEQHDELDVEKTWKPD
1802|gene|hwa       REHLVVTIEVADVEFARFANRLRVGGEIISCSREDELGHYHTLNVESHDEIIVTKKFAPD
2030|gene|hla       REHLFVTLQVDEVEFARFANRLRVSGVIVGCSREDQLNAHHTINVEEHDEITVEKHFKPD
13920|gene|hbo      REHMHVTISVSDVEFARFANRLRVGGEIVDCSREDQLGHHHTLNVEEHDEVTIEKHFKPD
4344|gene|nph       REPMWIRIDVNNVEFAKFANRLRVGGDIVDCSREDQLGFHHTFNVEEHDELTVEKVWQVD
10965|gene|hma      REPMWIQIEVTDVEFAKFANRLRVGGEIVDCSREDQLGFHHTLNVEEHTELTVEKHLKPD
1595|gene|hhi       REPMWIQIEVTDVEFAKFANRLRVGGEIVDCSREDQLGFHHTLNVEEHTELTVEKHLKPD
                                           * *       * :                       *

4204|hp|hhi         AVLREAEGVPPEVLRELALA----------------------------------------
1506|gene|nrc1      QLNRLNEAVEATDQPDVAIATVEEGEAHIHVVQQYGVDEQGSFTATTGKGEQNDRGRDEL
2924|gene|hut       QMDRIEEAVEATDVPDVAIVTVEEAQAYVHTVEQYGTEERASIAGPTGKGE-YARPREEL
1802|gene|hwa       QRKRIEAAEEAAENADVAVATIEEGEAHIHTVAQYGTEEQFSRTATTGKGE-YSQPRTEL
2030|gene|hla       QTERLEEATEAAENPDVAIATVEEGAAYVHTVQQYGTEEYASFTKPTGKGD-YSRPREEL
13920|gene|hbo      QLDRIEEAEQAAENPDVVIATVEEGEAHIHTVAQYGTEERFSFTAPTGKGE-YARPRSEL
4344|gene|nph       QLERLEEAVEAAEQPDVAIATVEEGQAHIHTVAQYGVEERASITGTTGKGE-YARSRDEL
10965|gene|hma      QADRLEEAVEATENPDVAIATVEEGEAHVHTVAQYGTEERATITSTTGKGE-YARPRKEL
1595|gene|hhi       QADRLEEAVEATENPDVAIATVEEGEAHVHTVAQYGTEERATITSTTGKGE-YARPRKEL
                       *   .  .    ::.:.                                        

4204|hp|hhi         ---------------------GLTLQPT--------PAQNEHQHVVATA-----------
1506|gene|nrc1      FGTLADALARMQADAIILAGPGFTKQDALDHITEEYPDLQETITMVDTSAVGGRGVHEVL
2924|gene|hut       FGELTDVLKRTDADAIILAGPGFTKQDALAYIEDEAPAVADSIRTVDTSAVGDRGVHEVL
1802|gene|hwa       FAEFAAALSRMDVDAIILAGPGFTKQDAEEYIQSNNPEIIDKLTIVDTAAVGDRGVHEVL
2030|gene|hla       FAELGEALAHLDADAVILAGPGFTKQDALDYITEEYRDLADRITTVDTSAAGDRGVHEVL
13920|gene|hbo      FAELGKALSRMDVDAIILAGPGFTKQDARDYIAENHRDVVDKITVVDTSSVGDRGVHEVL
4344|gene|nph       FEELAAILRRLDAEAIILAGPGFTKQDALEHIEDNAPEAAEKIQVVDTASVGDRGVHEVL
10965|gene|hma      FDELASVLKRQDVDAYILAGPGFTKQDALDHFQDEIPDIAEQITVVDTSAVGDRGVHEVL
1595|gene|hhi       FDELASVLKRQDVDAYILAGPGFTKQDALDHFQDEIPDIAEQITVVDTSAVGDRGVHEVL
                                         *:* * :            :    * *:           

4204|hp|hhi         ------------------------------------------------------------
1506|gene|nrc1      KRGAVEDVQEETRIAEESELIDELTTQMATDGKAAYGIDEVQKAVEFGAVEDLLILDERL
2924|gene|hut       KRGAVEDVQEETRIAEEATLIDELMERIATGAKVSYGPDAVAEAAEYGAIEHLLVLDEPL
1802|gene|hwa       KRGAVDEVQTQTRISAEAELIDELMEGIATGEKIAYGIDEVAKAAEFGAVDDLLVVDDQL
2030|gene|hla       KRGAVDEVQKETRISKEATLIDDLTAEIAQGAKATYGPEDVAEAAEFGAIETLLVVDDRL
13920|gene|hbo      KRGAVDEVQTQTRISKEADLIDDLMEGISTGEKVAYGIEEVAEAAEFGAVETLLVLDERL
4344|gene|nph       KRGAVDRIQTETRVSKEAELIDELMERIGEGEKAAYGVDEVAEAAEFGAIETLLILDERL
10965|gene|hma      KRGAVEDVQQQTRIAEEADYIDELMARIGSGSEVAYGPEEVAKAADYGAIETLLVLDERL
1595|gene|hhi       KRGAVEDVQQQTRIAEEADYIDELMERIGSGSEVAYGPEEVAKAADYGAIETLLVLDERL
                                                                                

4204|hp|hhi         ----------------------------------------------------------
1506|gene|nrc1      RLERAGEGDWVDVDVNDLVRTVEQQGGSVTVFSHEFAPGEQLRNLGGIGAVLRYRLD-
2924|gene|hut       RRARDEGDNW-DIDVDRVIERTEQQGGEVTVFSREFDPGQQLSNLGGIAALLRYRLES
1802|gene|hwa       REERRDSGDW-STDVDTVLQNVEQQGGSVTVLSGEFDPGQRLRNLGGIAALLRYRLQ-
2030|gene|hla       RTERQGEGDW-SIDVNEVIESVEQQGGDVVVFSSEFAPGEQLSNLGGIAAILRYRLQ-
13920|gene|hbo      REERQGAGEW-DVDVNEVIQTVERQGGDVAVFSSEFDPGRQLKNLGGIAAILRYRLQ-
4344|gene|nph       REERAGEGDW-AVDVNDIIENVEQQGGEVVVFSHEFDPGQQLANLGGIAALLRYRLS-
10965|gene|hma      RLERAGEGDW-DIDVDQIIETTEQKGGDVTVFSAEFAPGQQLSNLGGVAALLRYRLD-
1595|gene|hhi       RLERAGEGDW-DIDVDQIIETTEQKGGDVTVFSAEFAPGQQLSNLGGIAALLRYRLD-