HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0050COG1522arCOG01580transcription regulator

HOG Organism Gene ID Name Annotation
cHOG0050 nrc1 VNG2094 aclR7 transcription regulator
cHOG0050 hmu HMUK0921 Hmuk_0921 transcriptional regulator, AsnC family
cHOG0050 hmu HMUK0708 Hmuk_0708 transcriptional regulator, AsnC family
cHOG0050 hma RRNAC2622 asnC4 AsnC family transcriptional regulator
cHOG0050 hma RRNAC2779 asnC1 AsnC family transcriptional regulator
cHOG0050 hwa HQ3642A lrp AsnC family transcriptional regulator
cHOG0050 hla HLAC2373 Hlac_2373 transcriptional regulator, AsnC family
cHOG0050 hbo HBOR29500 Hbor_29500 transcriptional regulator, AsnC family
cHOG0050 hut HUTA1538 Huta_1538 transcriptional regulator, AsnC family
cHOG0050 hvo HVO_0240 HVO_0240 trh transcription regulator AsnC family
cHOG0050 nph NP0078A transcription regulator
cHOG0050 hhi 3039 asnC5 AsnC family transcriptional regulator
cHOG0050 hhi 64 asnC1 AsnC family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


12622|gene|hma      -MVDDTDREVVNALLQDGRASARDIAAATGIAATTVSRRMDDLESTGVIDEYTVDIDYGA
3039|gene|hhi       -MVDDTDRQVVNALLQDGRASARDVAAATGIAATTVSRRMDDLEATGVIDEYTVDIDYGA
2094|gene|nrc1      MTYENLDVKLVNELLGDGRASLRSLADDLDVSVTTVSNHLQTLEDEGAVNGYTPVVDYER
78|gene|nph         MTYENLDKKLVNALLEDGRASLRSLGEDLDVSVTTVSNHISDLEDDGIIEGYTPVVNYGK
1538|gene|hut       MTYENLDRKLINALLDDGRASLRSLADDLDVSVTTVSNHLSTLEEEGIIEGYTPKVDYDK
12779|gene|hma      MTYENLDRELVNALLGDGRASLRSLGEDLDVSVTTVSNHLSDLEDEGIINGYTPKVDYDK
64|gene|hhi         MTYENLDRELVNALLGDGRASLRSLGEDLDVSVTTVSNHLSDLEDEGIINGYTPKVDYDK
2373|gene|hla       MTYENLDAKLVNSLLSNGRASLRSLGDELDVSVTTVSNHLRDLEEEGVIRGYTPIVDYDK
3642|gene|hwa       MTYENLDAKLINALLGDGRASLRSLAEELDVSVTTVSNHLRDLENESVVEGYTPRVNYDA
29500|gene|hbo      MTYENLDAKLINALLGDGRASLRSLAEELDVSVTTVSNHLRDLEDEGVIEGYTPRVNYDA
                       :: * :::* ** :**** *.:.   .::.****..:  **  . :  **  ::*  

12622|gene|hma      LGYDVTAVFQLSVEGDGLGRVVDQLRDRREMVAVYEVTGDHDIVAVGKFTDTQSMNERIK
3039|gene|hhi       LGYDVTAVFQLSVEGDGLGRVVDQLRDRREMIAVYEVTGDHDIVAVGKFTDTQSMNERIK
2094|gene|nrc1      LGYDVTAILQLKVDGTALPEITGTLRGHKQMVSVYEITGDYDVLAIGKFTDTDDMNTLIK
78|gene|nph         LGYDVTAIIQMKVEGSSLPDITDDLREHKHMVSVYEVTGDHDIIAVGKFTDTDHMNEQIK
1538|gene|hut       IGYDVTAILQLKVEGSALPEVTESLREHEQMVSVYEVTGDYDIIAVGKFADTDDMNAQIK
12779|gene|hma      LGYDVTAIIQLKVEGSSLPAVTEDLKEHKQMISVYEVTGDYDIIAVGKFTDTDGMNAQIK
64|gene|hhi         LGYDVTAIIQLKVEGSSLPAVTDDLEEHKQMISVYEVTGDYDVIAVGKFTDTDGMNAQIK
2373|gene|hla       LGYDVTAVLQLKVEGSALPDVTEKLRQEKQMVSVYEVTGDYDVIAIGKFTDTDGMNAQIK
3642|gene|hwa       IGYDVTAIIQLKVEGSALPSITNRLEKQKQMTTVYEVTGDYDVIAVGKFRDTDGMNDQIK
29500|gene|hbo      LGYDVTAIIQLKVEGSALPEITERLREQKQMISVYEVTGDYDIIAIGKFTDTDGMNSQIK
                    :******::*:.*:* .*  :.  *     * :***:***:*::*:*** **: **  **

12622|gene|hma      TLLTDEDIRSASTSVVLNTVCEHEQFPVDGTDA-
3039|gene|hhi       TLLTDEDIRSASTSVVLNTVCEHEQFPVDGTDA-
2094|gene|nrc1      ELLADADINESSTSVVLNAAAENEQFELDLDGDA
78|gene|nph         ELLVDPEIKESNTSVVLNTVAENEQFELDY----
1538|gene|hut       SLLTDPAILESNTSVVLNAAVEHEQFELEVEE--
12779|gene|hma      ELLTDPDIRESNTSVVLNAASEHEQFDLDLKE--
64|gene|hhi         ELLTDPDIRESNTSVVLNAASEHEQFDLDLKE--
2373|gene|hla       SILTDADIRESNTSVVLNAVTENEQFDLDLNEE-
3642|gene|hwa       ELLTDTDIRESNTSVVLNPVAENEQFNLTLTE--
29500|gene|hbo      QLLTDADIRESNTSVVLNAVVENEQFDLDIDE--
                     :*.*  * .:.******.. *:*** :